hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-16125194/chunk_1/iprscan-20080502-16125194.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1907 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00180 700.7 4e-206 16 SM00281 198.0 8.5e-55 1 SM00181 79.8 3.4e-19 10 SM00136 -19.9 3.6e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00136 1/1 1 101 [. 1 282 [] -19.9 3.6e-10 SM00180 1/16 103 159 .. 1 42 [] 37.6 1.6e-06 SM00181 1/10 158 209 .. 1 32 [] 2.0 1.7e+02 SM00180 2/16 162 229 .. 1 42 [] 51.1 1.4e-10 SM00181 2/10 228 262 .. 1 32 [] 10.4 31 SM00180 3/16 232 274 .. 1 42 [] 38.7 7.7e-07 SM00180 4/16 297 341 .. 1 42 [] 51.5 1.1e-10 SM00181 3/10 308 342 .. 1 32 [] 8.6 44 SM00181 4/10 343 388 .. 1 32 [] 7.3 57 SM00180 5/16 344 387 .. 1 42 [] 51.7 9.4e-11 SM00180 6/16 390 432 .. 1 42 [] 45.9 5.2e-09 SM00181 5/10 391 433 .. 1 32 [] 16.2 4.7 SM00180 7/16 435 477 .. 1 42 [] 31.5 0.00012 SM00181 6/10 436 478 .. 1 32 [] 12.0 22 SM00180 8/16 480 523 .. 1 42 [] 51.1 1.4e-10 SM00181 7/10 481 524 .. 1 32 [] 0.6 2.2e+02 SM00180 9/16 527 576 .. 1 42 [] 33.6 2.6e-05 SM00181 8/10 527 580 .. 1 32 [] 2.7 1.5e+02 SM00180 10/16 579 629 .. 1 42 [] 44.9 1e-08 SM00180 11/16 632 676 .. 1 42 [] 35.4 7.8e-06 SM00180 12/16 1241 1284 .. 1 42 [] 45.9 5.4e-09 SM00180 13/16 1287 1328 .. 1 42 [] 19.3 0.23 SM00181 9/10 1330 1378 .. 1 32 [] 9.9 34 SM00180 14/16 1331 1377 .. 1 42 [] 51.9 8.1e-11 SM00180 15/16 1380 1428 .. 1 42 [] 59.2 5.1e-13 SM00281 1/1 1491 1621 .. 1 144 [] 198.0 8.5e-55 SM00181 10/10 1666 1714 .. 1 32 [] 10.1 33 SM00180 16/16 1667 1713 .. 1 42 [] 51.2 1.4e-10 Alignments of top-scoring domains: SM00136: domain 1 of 1, from 1 to 101: score -19.9, E = 3.6e-10 *->agrprrCyPefvNlAfgRkrpvtAtsTCGeqkrprPErYCklvghta KIAA1907 - ----------------------------------------------- - etdliWsllekprteqgkkCdlCDarqptkedprrsHpasnltDlnnpnn r KIAA1907 1 -------------------------R------------------------ 1 ptWWQSeplsnGpqynnVnLTLdLgkeFevtYVilkFcPNSPRPeslail F+ P KIAA1907 2 ------------------------------------FG-----P------ 4 erStDfGkTWqPwQyySsqdaeCrrtFGrpprgaitkggneqeviCtsey q + +it+ ++ +iCt+ey KIAA1907 5 ------------------Q-----------TLERITR---DDAAICTTEY 22 sdisPlegGeiafslLegRPsaedfdnSpvLQewvtATdiRvrltRLntp s+i+Ple+Gei++sl++gRP+a +f +Sp L+e+++AT++R+r++R+nt KIAA1907 23 SRIVPLENGEIVVSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNT- 71 lgddlmdvnskeleerDpevtrrYyYaIsDlaVGG<-* l+++lm ++ rDp+vtrrYyY+I+D+++GG KIAA1907 72 LLGHLMGKAL-----RDPTVTRRYYYSIKDISIGG 101 SM00180: domain 1 of 16, from 103 to 159: score 37.6, E = 1.6e-06 *->CdCnlpppvG....Cdp.......tGqClnCkpnttGGrrCdderCa C C+ G+ + Cd ++++++ qC C++nt+G Cd rC+ KIAA1907 103 CVCH-----GhadaCDAkdptdpfRLQCT-CQHNTCG-GTCD--RCC 140 pGyy.............gC<-* pG+++++ ++ + ++ ++C KIAA1907 141 PGFNqqpwkpatansanEC 159 SM00181: domain 1 of 10, from 158 to 209: score 2.0, E = 1.7e+02 *->eCa..pCsnGgtEqnGtCi....................sytC..Cp eC++ C ++ C +++ ++++ + + +++ ++ C +C+ KIAA1907 158 ECQscNCYGHA----TDCYydpevdrrrasqsldgtyqgGGVCidCQ 200 gpGytg.rCe<-* + tg +Ce KIAA1907 201 -HHTTGvNCE 209 SM00180: domain 2 of 16, from 162 to 229: score 51.1, E = 1.4e-10 *->CdCnlpppvG....Cdp...................tGqClnCkpnt C+C+ G+ ++C+++++ ++++ +++ +++ +++G+C++C+++t KIAA1907 162 CNCY-----GhatdCYYdpevdrrrasqsldgtyqgGGVCIDCQHHT 203 tGGrrCdderCapGyy...........gC<-* tG +C+ rC+pG+y++++++ ++++ C KIAA1907 204 TG-VNCE--RCLPGFYrspnhpldsphVC 229 SM00181: domain 2 of 10, from 228 to 262: score 10.4, E = 31 *->eCa..pCsnGgtEqnGtCi..sytC.CpgpGytg.rCe<-* C + C+ + t +GtC + + +C C+ p ++g+rC KIAA1907 228 VCRrcNCESDFT--DGTCEdlTGRCyCR-PNFSGeRCD 262 SM00180: domain 3 of 16, from 232 to 274: score 38.7, E = 7.7e-07 *->CdCnlpppvG....Cdp.tGqClnCkpnttGGrrCdderCapGyy.. C+C ++ ++++C+ tG+C C+pn G +rCd Ca+G+ + KIAA1907 232 CNCE---SDFtdgtCEDlTGRCY-CRPNFSG-ERCD--VCAEGFTgf 271 .gC<-* ++C KIAA1907 272 pSC 274 SM00180: domain 4 of 16, from 297 to 341: score 51.5, E = 1.1e-10 *->CdCnlpppvG.....Cdp...tGqClnCkpnttGGrrCdderCapGy CdC+ ++G++++ C ++++ G+Cl Ckpn +G +C+ CapG+ KIAA1907 297 CDCS---AAGtqgnaCRKdprVGRCL-CKPNFQG-THCE--LCAPGF 336 y..gC<-* y++gC KIAA1907 337 YgpGC 341 SM00181: domain 3 of 10, from 308 to 342: score 8.6, E = 44 *->eCa......pCsnGgtEqnGtCi....sytC..CpgpGytg.rCe<- C ++++ + C C ++ + +C+ C+ pG++g+ C+ KIAA1907 308 ACRkdprvgRCL---------CKpnfqGTHCelCA-PGFYGpGCQ 342 * KIAA1907 - - SM00181: domain 4 of 10, from 343 to 388: score 7.3, E = 57 *->eCa.........pCsnGgtEqnGtCi......sytC..CpgpGytg. +C+ ++++ ++ C+++ G+C+ + + ++ tC++C+ pGy KIAA1907 343 PCQcsspgvaddRCDPDT----GQCRcrvgfeGATCdrCA-PGYFHf 384 .rCe<-* + C+ KIAA1907 385 pLCQ 388 SM00180: domain 5 of 16, from 344 to 387: score 51.7, E = 9.4e-11 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. C+C+ + G +++Cdp+tGqC+ C+ + +G Cd rCapGy++ KIAA1907 344 CQCS---SPGvaddrCDPdTGQCR-CRVGFEG-ATCD--RCAPGYFh 383 ..gC<-* + C KIAA1907 384 fpLC 387 SM00180: domain 6 of 16, from 390 to 432: score 45.9, E = 5.2e-09 *->CdCnlpppvG.....CdptGqClnCkpnttGGrrCdderCapGyy.. C C+ p+G+ +++Cd G+Cl C+p +G ++Cd rC+pGy++ KIAA1907 390 CGCS---PAGtlpegCDEAGRCL-CQPEFAG-PHCD--RCRPGYHgf 429 .gC<-* ++C KIAA1907 430 pNC 432 SM00181: domain 5 of 10, from 391 to 433: score 16.2, E = 4.7 *->eCa.......pCsnGgtEqnGtCi......sytC..CpgpGytg..r C++ ++ +++C++ G+C+ ++ +++C++C+ pGy+g ++ KIAA1907 391 GCSpagtlpeGCDEA-----GRCLcqpefaGPHCdrCR-PGYHGfpN 431 Ce<-* C+ KIAA1907 432 CQ 433 SM00180: domain 7 of 16, from 435 to 477: score 31.5, E = 0.00012 *->CdCnlpppvG.....CdptGqClnCkpnttGGrrCdderCapGyy.. C C+ p+G ++ C +G C+ C+p++tG C +C pG+++ KIAA1907 435 CTCD---PRGaldqlCGAGGLCR-CRPGYTG-TACQ--ECSPGFHgf 474 .gC<-* ++C KIAA1907 475 pSC 477 SM00181: domain 6 of 10, from 436 to 478: score 12.0, E = 22 *->eCa.......pCsnGgtEqnGtCi......sytC..CpgpGytg..r C++++ ++ C+ G G C+ +++ ++ C++C pG++g ++ KIAA1907 436 TCDprgaldqLCGAG-----GLCRcrpgytGTACqeCS-PGFHGfpS 476 Ce<-* C+ KIAA1907 477 CV 478 SM00180: domain 8 of 16, from 480 to 523: score 51.1, E = 1.4e-10 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. C+C+ + G+ + Cdp++GqC C+p +tG rCd C pG y+ KIAA1907 480 CHCS---AEGslhaaCDPrSGQCS-CRPRVTG-LRCD--TCVPGAYn 519 ..gC<-* + C KIAA1907 520 fpYC 523 SM00181: domain 7 of 10, from 481 to 524: score 0.6, E = 2.2e+02 *->eCa.......pCsnGgtEqnGtCi......sytC..CpgpGytg..r C+ +++ + C++ G+C +++ ++ +C++C pG + ++ KIAA1907 481 HCSaegslhaACDPRS----GQCScrprvtGLRCdtCV-PGAYNfpY 522 Ce<-* Ce KIAA1907 523 CE 524 SM00180: domain 9 of 16, from 527 to 576: score 33.6, E = 2.6e-05 *->CdCnlpppvG........CdptGqClnCkpnttGGrrCdderCapGy C+ p+G + ++ + C C+ +++G + Cd rC+pG+ KIAA1907 527 -SCH---PAGlapvdpalPEAQVPCM-CRAHVEG-PSCD--RCKPGF 565 y........gC<-* ++ ++++++gC KIAA1907 566 WglspsnpeGC 576 SM00181: domain 8 of 10, from 527 to 580: score 2.7, E = 1.5e+02 *->eCa................pCsnGgtEqnGtCi....sytC..Cpgp C++ + + ++ ++ + pC C+ + ++++C++C+ p KIAA1907 527 SCHpaglapvdpalpeaqvPCM---------CRahveGPSCdrCK-P 563 Gytg..........rCe<-* G+ g +++++++ +rC KIAA1907 564 GFWGlspsnpegctRCS 580 SM00180: domain 10 of 16, from 579 to 629: score 44.9, E = 1e-08 *->CdCnlpppvG.......Cdp.tGqClnCkpnttGGrrCdderCapGy C C+ +G+ ++ +C p+tGqC Ckp+++G + C C++G+ KIAA1907 579 CSCD---LRGtlggvaeCQPgTGQCF-CKPHVCG-QACA--SCKDGF 618 y........gC<-* ++ ++ + gC KIAA1907 619 FgldqadyfGC 629 SM00180: domain 11 of 16, from 632 to 676: score 35.4, E = 7.8e-06 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. C C+ +G +++C+p+tG+C+ C+pnt+G + C + a +y KIAA1907 632 CRCD---IGGalgqsCEPrTGVCR-CRPNTQG-PTCS--EPARDHYl 671 ...gC<-* ++ + KIAA1907 672 pdlHH 676 SM00180: domain 12 of 16, from 1241 to 1284: score 45.9, E = 5.4e-09 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. C C+ vG ++++C+p +GqC+ C +++G r C rCa Gy++ KIAA1907 1241 CGCH---EVGatgptCEPfGGQCP-CHAHVIG-RDCS--RCATGYWg 1280 ..gC<-* ++C KIAA1907 1281 fpNC 1284 SM00180: domain 13 of 16, from 1287 to 1328: score 19.3, E = 0.23 *->CdCnlpppvG...Cdp.tGqClnCkpnttGGrrCdderCapGyy... CdC G + Cd tGqC+ C p t+ + C C+p ++ + KIAA1907 1287 CDC------GarlCDElTGQCI-CPPRTIP-PDCL--LCQPQTFgch 1323 ...gC<-* + gC KIAA1907 1324 plvGC 1328 SM00181: domain 9 of 10, from 1330 to 1378: score 9.9, E = 34 *->eCa............pCsnGgtEqnGtCi......sytC..CpgpGy eC ++++ ++ +++ C+ + G+C +++ ++ +C++C pG+ KIAA1907 1330 ECNcsgpgiqeltdpTCDTDS----GQCKcrpnvtGRRCdtCS-PGF 1371 tg..rCe<-* +g +rC KIAA1907 1372 HGypRCR 1378 SM00180: domain 14 of 16, from 1331 to 1377: score 51.9, E = 8.1e-11 *->CdCnlpppvG..........Cdp.tGqClnCkpnttGGrrCdderCa C+C+ G++ ++ ++++Cd ++GqC C+pn+tG rrCd C KIAA1907 1331 CNCS-----GpgiqeltdptCDTdSGQCK-CRPNVTG-RRCD--TCS 1368 pGyy...gC<-* pG+++ + C KIAA1907 1369 PGFHgypRC 1377 SM00180: domain 15 of 16, from 1380 to 1428: score 59.2, E = 5.1e-13 *->CdCnlpppvG.....Cdp.tGqClnCkpnttGGrrCdderCapGyy. CdC+ +G+ ++ Cdp tGqC Ck+n++G ++Cd +C G ++ KIAA1907 1380 CDCH---EAGtapgvCDPlTGQCY-CKENVQG-PKCD--QCSLGTFs 1419 .......gC<-* + +++gC KIAA1907 1420 ldaanpkGC 1428 SM00281: domain 1 of 1, from 1491 to 1621: score 198.0, E = 8.5e-55 *->daepvYWkaPeqFLQGDkvtSYGGkLkYtlsyegregevdgntlsrq + ++YW+aP+++L GD+v+SYGG+L+Y+l++e ++g+v+ sr KIAA1907 1491 AFPELYWQAPPSYL-GDRVSSYGGTLRYELHSETQRGDVFVPMESR- 1535 DvpDViLeGndngirlshralvaqgpplPdeettvevrfrEenwqyfgss pDV+L+Gn ++++ + ++++p P+ ++++++++E+n+++ + + KIAA1907 1536 --PDVVLQGN--QMSITFL---EPAYPTPGHVHRGQLQLVEGNFRHTE-T 1577 gqPvtReelFmmvLadLdailIRATyYseqqlasyrLsdVsLevAvp<-* +++v+Reel mmvLa+L++++IRA+ +s+ + a+ +L++V LevA+p KIAA1907 1578 RNTVSREEL-MMVLASLEQLQIRAL-FSQISSAV-SLRRVALEVASP 1621 SM00181: domain 10 of 10, from 1666 to 1714: score 10.1, E = 33 *->eCa......pCsnGgtEqnGtCi.......sytC..CpgpGytg... +C+ +++++ C +G G+C++ +++++ +C++C+ +G++ +++ KIAA1907 1666 PCQchghsdRCLPGS----GVCVdcqhnteGAHCerCQ-AGFMSsrd 1707 ....rCe<-* +++ C+ KIAA1907 1708 dpsaPCV 1714 SM00180: domain 16 of 16, from 1667 to 1713: score 51.2, E = 1.4e-10 *->CdCnlpppvG....Cdp.tGqClnCkpnttGGrrCdderCapGyy.. C+C+ G++++C p++G+C++C++nt+G +C+ rC+ G+ ++ KIAA1907 1667 CQCH-----GhsdrCLPgSGVCVDCQHNTEG-AHCE--RCQAGFMss 1705 ......gC<-* +++++ C KIAA1907 1706 rddpsaPC 1713 //