hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-16060363/chunk_1/iprscan-20080502-16060363.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1903
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00717                                                  40.3    2.7e-07   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00717    1/1     758   810 ..     1    53 []    40.3  2.7e-07

Alignments of top-scoring domains:
SM00717: domain 1 of 1, from 758 to 810: score 40.3, E = 2.7e-07
                   *->kkgeWteeEdelLleavkkyGkgtdndWakIakelpgRtpkqcrerw
                        +eW+e E ++L +a + ++k +++ W+++a  +++R+p++c++++
    KIAA1903   758    QDKEWNEKELQKLHCAFASLPKHKPGFWSEVAAAVGSRSPEECQRKY 804  

                   rnllkp<-*
                    ++ +    
    KIAA1903   805 MENPRG    810  

//