hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-14543718/chunk_1/iprscan-20080502-14543718.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1862
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N 
--------  -----------                                   -----    ------- ---
SM00349                                                  72.9      4e-17   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
SM00349     1/1      12    74 ..     1    62 []    72.9    4e-17

Alignments of top-scoring domains:
SM00349: domain 1 of 1, from 12 to 74: score 72.9, E = 4e-17
                   *->VtFeDVAVdFsqEEWeqLDpaQrnLYRdVMlENYsnLvSLGgfqvsk
                       tF+D AV Fs+EEW++L+  Qr++YRdVM+ENY++LvS+G  +   
    KIAA1862    12    ITFKDLAVRFSEEEWRLLEEGQREFYRDVMRENYETLVSVG-TAELL 57   

                   p..dliskLEqgeEpwi<-*
                   p + ++s  E g   +    
    KIAA1862    58 PlsAFLSPSEPGRAVGG    74   

//