hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-14543718/chunk_1/iprscan-20080502-14543718.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1862 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01352.17.fs KRAB box 81.3 2e-22 1 PF01352.17.ls KRAB box 83.2 7.2e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01352.17.fs 1/1 12 52 .. 1 41 [] 81.3 2e-22 PF01352.17.ls 1/1 12 52 .. 1 41 [] 83.2 7.2e-22 Alignments of top-scoring domains: PF01352.17.fs: domain 1 of 1, from 12 to 52: score 81.3, E = 2e-22 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* +tF+D aV F++EEW+lL++ Qr++YrdVM+ENy++LvS+g KIAA1862 12 ITFKDLAVRFSEEEWRLLEEGQREFYRDVMRENYETLVSVG 52 PF01352.17.ls: domain 1 of 1, from 12 to 52: score 83.2, E = 7.2e-22 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* +tF+D aV F++EEW+lL++ Qr++YrdVM+ENy++LvS+g KIAA1862 12 ITFKDLAVRFSEEEWRLLEEGQREFYRDVMRENYETLVSVG 52 //