hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-13005141/chunk_1/iprscan-20080502-13005141.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1795 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF05225.6.fs helix-turn-helix, Psq domain 63.1 1.3e-16 1 PF05225.6.ls helix-turn-helix, Psq domain 65.1 2.1e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF05225.6.fs 1/1 489 534 .. 1 48 [] 63.1 1.3e-16 PF05225.6.ls 1/1 489 534 .. 1 48 [] 65.1 2.1e-16 Alignments of top-scoring domains: PF05225.6.fs: domain 1 of 1, from 489 to 534: score 63.1, E = 1.3e-16 *->teedlaeAleavrknGkimSirkAArkYGiPrSTLygrrlrggislk e l+eA++ v+ +Gk mS++kA+++YGiP+STL+++++++ +lk KIAA1795 489 NSEILEEAISVVM-SGK-MSVSKAQSIYGIPHSTLEYKVKERLGTLK 533 r<-* + KIAA1795 534 N 534 PF05225.6.ls: domain 1 of 1, from 489 to 534: score 65.1, E = 2.1e-16 *->teedlaeAleavrknGkimSirkAArkYGiPrSTLygrrlrggislk e l+eA++ v+ +Gk mS++kA+++YGiP+STL+++++++ +lk KIAA1795 489 NSEILEEAISVVM-SGK-MSVSKAQSIYGIPHSTLEYKVKERLGTLK 533 r<-* + KIAA1795 534 N 534 //