hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12334660/chunk_1/iprscan-20080502-12334660.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1779 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00091 50.6 2e-10 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00091 1/2 139 211 .. 1 68 [] 15.8 2.5 SM00091 2/2 286 352 .. 1 68 [] 34.8 1.2e-05 Alignments of top-scoring domains: SM00091: domain 1 of 2, from 139 to 211: score 15.8, E = 2.5 *->erlrailes.....lpdgiivld.ldGrilyaNpaaeellGyspeel e+l++i + ++++++++++ v + l Gr +++++ a+ +l++ ++ l KIAA1779 139 EELATIASEhtsknTDTFVAVFSfLSGRLVHISEQAALILNRKKDVL 185 iGksllelihpedrlleevqe.lqrlla<-* ++ +l+ p+d+ + ++ r++ KIAA1779 186 ASSHFVDLLAPQDM--RVFYAhTARAQL 211 SM00091: domain 2 of 2, from 286 to 352: score 34.8, E = 1.2e-05 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + +i + + +++ +l+++++a llGy p++liG+s+l KIAA1779 286 YEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQDLIGTSIL 332 elihpedrlleevqe.lqrlla<-* ++hpedr + + +q++l+ KIAA1779 333 SYLHPEDR--SLMVAiHQKVLK 352 //