hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12301636/chunk_1/iprscan-20080502-12301636.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1777 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00209 97.2 2e-24 2 SM00218 85.0 8.9e-21 1 SM00005 54.9 1e-11 1 SM00409 44.0 2e-08 1 SM00408 43.4 2.9e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00409 1/1 166 251 .. 1 58 [] 44.0 2e-08 SM00408 1/1 172 239 .. 1 56 [] 43.4 2.9e-08 SM00209 1/2 256 307 .. 1 66 [] 58.6 8.3e-13 SM00209 2/2 312 361 .. 1 66 [] 38.6 8.3e-07 SM00218 1/1 541 643 .. 1 115 [] 85.0 8.9e-21 SM00005 1/1 848 939 .. 1 108 [] 54.9 1e-11 Alignments of top-scoring domains: SM00409: domain 1 of 1, from 166 to 251: score 44.0, E = 2e-08 *->pp.vtvkeGesvtLtC.as......titWy................. p++ +v + ++L+C+ + + + ++ W+++ + ++ ++ + +++ KIAA1777 166 PQgREVPIEGMIVLHCrPPegvpaaEVEWLkneepidseqdenidtr 212 ....LtI.nvtpeDsesgGtYtCaat..sgsasseqgttLtVl<-* +++L+I++++++Ds G+YtC+a + + s ++t+ V+ KIAA1777 213 adhnLIIrQARLSDS---GNYTCMAAniVAKRRS-LSATVVVY 251 SM00408: domain 1 of 1, from 172 to 239: score 43.4, E = 2.9e-08 *->leGqsVtLtCp.asgdpvpnItWlk.gkplp..........sgstLt + + ++L C++ +g p++++ Wlk+++p++++++++ +++ + L KIAA1777 172 PIEGMIVLHCRpPEGVPAAEVEWLKnEEPIDseqdenidtrADHNLI 218 iknvsleDsGlYtCvArNsvg<-* i+ ++l+DsG+YtC A N v KIAA1777 219 IRQARLSDSGNYTCMAANIVA 239 SM00209: domain 1 of 2, from 256 to 307: score 58.6, E = 8.3e-13 *->wseWseWSpCSgvtCGgGgrtegvrtRtRsslrvccspppprnqngg ws+W+eWS+C v CG+G +++R+R+ c +p+p ngg KIAA1777 256 WSSWTEWSACN-VRCGRG-----WQKRSRT----CTNPAP---LNGG 289 epCs....EtrpCntqpnLqpCp<-* + C++ + ++ +C+ Cp KIAA1777 290 AFCEgmsvQKITCTS-----LCP 307 SM00209: domain 2 of 2, from 312 to 361: score 38.6, E = 8.3e-07 *->wseWseWSpCSgvtCGgGgrtegvrtRtRsslrvccspppprnqngg w WseWS CS C R R+ c ppp +ngg KIAA1777 312 WEVWSEWSVCS-PEC--------EHLRIRE----CTAPPP---RNGG 342 epCs....EtrpCntqpnLqpCp<-* + C++ ++E++ C+ C KIAA1777 343 KFCEglsqESENCTDG----LCI 361 SM00218: domain 1 of 1, from 541 to 643: score 85.0, E = 8.9e-21 *->psflvsgtvdsrGGrLrgprHsGvrliiPpgAipqGtryecYlvvhk + g ++ +GGrL p+ +Gv+l+iP gAip+ e+Y +++ KIAA1777 541 TELRTTGVFGHLGGRLVMPN-TGVSLLIPHGAIPEENSWEIYMSINQ 586 klstpPPLDkeegEtLLSPvvecGPCDVSmSAhGalllrPViLevpHCAs + P L ++E LLSP v+cGP ++ + + P L++pHCA+ KIAA1777 587 GE---PSLQSDGSEVLLSPEVTCGP-------PDMIVTTPFALTIPHCAD 626 lrprdkwelvllrsengg<-* ++ + w + l++ +g KIAA1777 627 VSSEH-WNIHLKKRTQQG 643 SM00005: domain 1 of 1, from 848 to 939: score 54.9, E = 1e-11 *->pagaaslteltreklaklldhpldlgddWreLArkLglseaeidqie ++ a++++ +r++++ d p+ +g+dW+ LA+k+ + +++ +++ KIAA1777 848 GPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSI-NRNLSYFA 893 tesprelnAyyeddlreqsyqlLrlWeqregkneqatlgtLleaLrkmgr t+s+ +s ++L+lWe+r+ + + l+ L+ aL+++gr KIAA1777 894 TQSS-------------PSAVILNLWEARHQHD--GDLDSLACALEEIGR 928 ddavellrsel<-* + + se+ KIAA1777 929 THTKLSNISES 939 //