hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11161465/chunk_1/iprscan-20080502-11161465.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1735 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00021 86.9 2.4e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00021 1/1 408 490 .. 1 86 [] 86.9 2.4e-21 Alignments of top-scoring domains: SM00021: domain 1 of 1, from 408 to 490: score 86.9, E = 2.4e-21 *->csetKViYhlDdEetPYlvkvpvpaervTLgdFKevLtkkgnYKYYf + tKV Y+ D tP +v +p + e vTL dFK++ + gn +Y f KIAA1735 408 STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHF 454 KslDdDfgCgvVKeEirdDsarLrPcfNGrvvswLvsve<-* K+lD++f g VKeEi+ D + P +G++v w++ KIAA1735 455 KALDPEF--GTVKEEIFHDDDAI-PGWEGKIVAWVEEDH 490 //