hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11161465/chunk_1/iprscan-20080502-11161465.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1735 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00778.8.fs DIX domain 87.0 2.6e-26 1 PF00778.8.ls DIX domain 88.9 1.4e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00778.8.fs 1/1 408 490 .. 1 87 [] 87.0 2.6e-26 PF00778.8.ls 1/1 408 490 .. 1 87 [] 88.9 1.4e-23 Alignments of top-scoring domains: PF00778.8.fs: domain 1 of 1, from 408 to 490: score 87.0, E = 2.6e-26 *->csetKViYhLDdEetPYlvkvpvpaervTLgdFKevLtkrngsYKYy + tKV Y+ D tP +v +p + e vTL dFK++ ++ g+ +Y KIAA1735 408 STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDRE-GNHRYH 453 fKslDpDfdCgvVKeEirdDsarLrPcfNgrvvswLvsve<-* fK+lDp+f g VKeEi+ D + P +g++v w++ KIAA1735 454 FKALDPEF--GTVKEEIFHDDDAI-PGWEGKIVAWVEEDH 490 PF00778.8.ls: domain 1 of 1, from 408 to 490: score 88.9, E = 1.4e-23 *->csetKViYhLDdEetPYlvkvpvpaervTLgdFKevLtkrngsYKYy + tKV Y+ D tP +v +p + e vTL dFK++ ++ g+ +Y KIAA1735 408 STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDRE-GNHRYH 453 fKslDpDfdCgvVKeEirdDsarLrPcfNgrvvswLvsve<-* fK+lDp+f g VKeEi+ D + P +g++v w++ KIAA1735 454 FKALDPEF--GTVKEEIFHDDDAI-PGWEGKIVAWVEEDH 490 //