hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11111197/chunk_1/iprscan-20080502-11111197.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1732 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00317 152.2 5.4e-41 1 SM00570 115.3 7.1e-30 1 SM00456 53.2 3.4e-11 1 SM00508 34.2 1.8e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00570 1/1 845 900 .. 1 62 [] 115.3 7.1e-30 SM00317 1/1 901 1024 .. 1 114 [] 152.2 5.4e-41 SM00508 1/1 1025 1041 .. 1 17 [] 34.2 1.8e-05 SM00456 1/1 1741 1773 .. 1 34 [] 53.2 3.4e-11 Alignments of top-scoring domains: SM00570: domain 1 of 1, from 845 to 900: score 115.3, E = 7.1e-30 *->ndimtCeCkplddDgelkGegaCgedsdClNRmmElliECsDpssCp +++m+CeC+pl++D+ ++Ge+aCg +dClNR+ l+iECs s+Cp KIAA1732 845 IKRMQCECTPLSKDERAQGEIACG--EDCLNRL--LMIECS--SRCP 885 cGsyCsNQrFQkrqy<-* +G+yCsN+rFQ++q+ KIAA1732 886 NGDYCSNRRFQRKQH 900 SM00317: domain 1 of 1, from 901 to 1024: score 152.2, E = 5.4e-41 *->aklevfkskgkGwGlratedIpkGefIleyvGeii............ a++ev +++kGwGlra++d+p ++f+ley+Ge++++++ + + ++ KIAA1732 901 ADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLdhkefkarvkey 947 ......fylfd......ciDatranggkGniarfiNHSCePNcelifvev ++++ +y+f+ ++++ iDat+ kGn++rf+NHSCePNce++++ v KIAA1732 948 arnkniHYYFMalkndeIIDATQ----KGNCSRFMNHSCEPNCETQKWTV 993 dgfdprgasdsadprivifAlrdIkpGEELtidYgddyege<-* +g r+++f+++ ++ G ELt+dY++ ++g+ KIAA1732 994 NG----------QLRVGFFTTKLVPSGSELTFDYQFQRYGK 1024 SM00508: domain 1 of 1, from 1025 to 1041: score 34.2, E = 1.8e-05 *->kkqpClCGaanCrGfLg<-* ++q+C+CG+anCrG+Lg KIAA1732 1025 EAQKCFCGSANCRGYLG 1041 SM00456: domain 1 of 1, from 1741 to 1773: score 53.2, E = 3.4e-11 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* lPp+W+ + dp+ G++YYy+++T++tqW++P++ KIAA1732 1741 VLPPNWKTARDPE-GKIYYYHVITRQTQWDPPTW 1773 //