hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-09370411/chunk_1/iprscan-20080502-09370411.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1678 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF05716.3.fs A-kinase anchor protein 110 kDa (AKAP 110) 18.3 1.3e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF05716.3.fs 1/1 1226 1301 .. 892 977 .] 18.3 1.3e-05 Alignments of top-scoring domains: PF05716.3.fs: domain 1 of 1, from 1226 to 1301: score 18.3, E = 1.3e-05 *->lqAvlqwvAAselNrvPilyfagddegiqekLlqlSAkAveKGySVG l A lqw+AAsel +P yf e ek l++ K VG KIAA1678 1226 LRATLQWIAASELG-IPTIYFKKSQENRIEKFLDVVQLVHRKSWKVG 1271 evLQsVlryeKERQlDEaverwpGNvtrlQLLDWlmvnL<-* ++ V +y K + E rl L DWl+ L KIAA1678 1272 DIFHAVVQYCK---MHEEQ-----KDGRLSLFDWLL-EL 1301 //