hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-08220281/chunk_1/iprscan-20080502-08220281.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1633 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07989.2.fs Microtubule associated 128.2 2.1e-35 3 PF07989.2.ls Microtubule associated 126.4 7.4e-35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07989.2.fs 1/3 108 170 .. 1 63 [] 124.4 3e-34 PF07989.2.ls 1/1 108 170 .. 1 63 [] 126.4 7.4e-35 Alignments of top-scoring domains: PF07989.2.fs: domain 1 of 3, from 108 to 170: score 124.4, E = 3e-34 *->LkKENFgLKLkIyFLeErLnkkseegiediiKeNiELKvevesLqRd LkKENF+LKL+IyFLeEr+++++ +++e+i+K+NiELKvevesL+R+ KIAA1633 108 LKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRE 154 lqgykkklsklekqle<-* lq+ +++l k++k++e KIAA1633 155 LQEREQLLIKASKAVE 170 PF07989.2.ls: domain 1 of 1, from 108 to 170: score 126.4, E = 7.4e-35 *->LkKENFgLKLkIyFLeErLnkkseegiediiKeNiELKvevesLqRd LkKENF+LKL+IyFLeEr+++++ +++e+i+K+NiELKvevesL+R+ KIAA1633 108 LKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRE 154 lqgykkklsklekqle<-* lq+ +++l k++k++e KIAA1633 155 LQEREQLLIKASKAVE 170 //