hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-07545781/chunk_1/iprscan-20080502-07545781.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1617 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02820.9.ls mbt repeat 326.4 4.7e-95 4 PF02820.9.fs mbt repeat 323.2 4.1e-94 4 PF07647.7.fs SAM domain (Sterile alpha motif) 23.9 2.3e-06 1 PF00536.20.fs SAM domain (Sterile alpha motif) 22.1 6.9e-06 1 PF02198.7.fs Sterile alpha motif (SAM)/Pointed domain 20.5 1.1e-05 1 PF02198.7.ls Sterile alpha motif (SAM)/Pointed domain 9.8 0.00011 1 PF07647.7.ls SAM domain (Sterile alpha motif) 25.9 0.00013 1 PF00536.20.ls SAM domain (Sterile alpha motif) 24.1 0.00046 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02820.9.fs 1/4 88 163 .. 1 77 [] 108.9 1.4e-29 PF02820.9.ls 1/4 88 163 .. 1 77 [] 110.9 3.4e-30 PF02820.9.ls 2/4 203 270 .. 1 77 [] 15.9 0.00017 PF02820.9.ls 3/4 314 391 .. 1 77 [] 85.6 1.4e-22 PF02820.9.fs 3/4 314 391 .. 1 77 [] 83.6 5.6e-22 PF02820.9.ls 4/4 422 492 .. 1 77 [] 114.0 4.1e-31 PF02820.9.fs 4/4 422 492 .. 1 77 [] 112.1 1.5e-30 PF02198.7.ls 1/1 819 898 .. 1 91 [] 9.8 0.00011 PF02198.7.fs 1/1 821 870 .. 7 65 .. 20.5 1.1e-05 PF07647.7.ls 1/1 831 897 .. 1 72 [] 25.9 0.00013 PF07647.7.fs 1/1 831 897 .. 1 72 [] 23.9 2.3e-06 PF00536.20.fs 1/1 832 895 .. 1 65 [] 22.1 6.9e-06 PF00536.20.ls 1/1 832 895 .. 1 65 [] 24.1 0.00046 Alignments of top-scoring domains: PF02820.9.fs: domain 1 of 4, from 88 to 163: score 108.9, E = 1.4e-29 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyraDfWchv MKLE+++++np +++vAT+++++G++ L+Lr+ G+ +++raDfWc+v KIAA1617 88 MKLEVANKNNPDTYWVATIITTCGQL-LLLRYCGYGEDRRADFWCDV 133 dSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +d++PvGWC++n+++L PP +++k+ + KIAA1617 134 VIADLHPVGWCTQNNKVLMPPDAIKEKYTD 163 PF02820.9.ls: domain 1 of 4, from 88 to 163: score 110.9, E = 3.4e-30 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyraDfWchv MKLE+++++np +++vAT+++++G++ L+Lr+ G+ +++raDfWc+v KIAA1617 88 MKLEVANKNNPDTYWVATIITTCGQL-LLLRYCGYGEDRRADFWCDV 133 dSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +d++PvGWC++n+++L PP +++k+ + KIAA1617 134 VIADLHPVGWCTQNNKVLMPPDAIKEKYTD 163 PF02820.9.ls: domain 2 of 4, from 203 to 270: score 15.9, E = 0.00017 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyraDfWchv E D +np+++++ V+e +G r LrLr+ G + + D+W+ KIAA1617 203 ---ELQDSQNPFQYWIVSVIENVGGR-LRLRYVGLEDTESYDQWLFY 245 dSpdIfPvGWCeknghkLqPPpGyrskkfs<-* + PvGWC +n++ PP ++ + KIAA1617 246 LDYRLRPVGWCQENKYRMDPP-----SEIY 270 PF02820.9.ls: domain 3 of 4, from 314 to 391: score 85.6, E = 1.4e-22 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyr.aDfWch MKLE v++++p+ i +A V++V+ ++++ +D+ ++e ++ +ch KIAA1617 314 MKLETVNMCEPFYISPASVTKVFNNHFFQVTIDDLRPEPSkLSMLCH 360 vdSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +dS I Pv+WC kng +L+PP+Gy ++f+ KIAA1617 361 ADSLGILPVQWCLKNGVSLTPPKGYSGQDFD 391 PF02820.9.fs: domain 3 of 4, from 314 to 391: score 83.6, E = 5.6e-22 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyr.aDfWch MKLE v++++p+ i +A V++V+ ++++ +D+ ++e ++ +ch KIAA1617 314 MKLETVNMCEPFYISPASVTKVFNNHFFQVTIDDLRPEPSkLSMLCH 360 vdSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +dS I Pv+WC kng +L+PP+Gy ++f+ KIAA1617 361 ADSLGILPVQWCLKNGVSLTPPKGYSGQDFD 391 PF02820.9.ls: domain 4 of 4, from 422 to 492: score 114.0, E = 4.1e-31 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyraDfWchv MKLEAv+prnp + CvA Vv V G++ ++L+++G +++ + + +++v KIAA1617 422 MKLEAVNPRNPGELCVASVVSVKGRL-MWLHLEGLQTPVP-EVIVDV 466 dSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +S+dIfPvGWCe+n+++L++P +k+ s KIAA1617 467 ESMDIFPVGWCEANSYPLTAP----HKTVS 492 PF02820.9.fs: domain 4 of 4, from 422 to 492: score 112.1, E = 1.5e-30 *->MKLEAvDprnpsliCvATVveVrGsrYLrLrfDGwdseyraDfWchv MKLEAv+prnp + CvA Vv V G++ ++L+++G +++ + + +++v KIAA1617 422 MKLEAVNPRNPGELCVASVVSVKGRL-MWLHLEGLQTPVP-EVIVDV 466 dSpdIfPvGWCeknghkLqPPpGyrskkfs<-* +S+dIfPvGWCe+n+++L++P +k+ s KIAA1617 467 ESMDIFPVGWCEANSYPLTAP----HKTVS 492 PF02198.7.ls: domain 1 of 1, from 819 to 898: score 9.8, E = 0.00011 *->pssfkkeqkrlgipadlRtdPrlWtedhVleWLewavkenkfsLepi + e++rl ++ +P +Wt ++V+++++ + +L++ KIAA1617 819 ----QEEEERLVLES----NPLEWTVTDVVRFIK-LTDC--APLAK- 853 dfskFadmsGkeLCsls....kedFleraPlfvGdiLwehLqiLrkas<- +f+++ d++G++L++l+ ++ +e+ + ++ ++ +L +++ + a+ KIAA1617 854 IFQEQ-DIDGQALLLLTlptvQECMELKLG--PAIKLCHQIERVKVAF 898 * KIAA1617 - - PF02198.7.fs: domain 1 of 1, from 821 to 870: score 20.5, E = 1.1e-05 *->eqkrlgipadlRtdPrlWtedhVleWLewavkenkfsLepidfskFa e++rl ++ +P +Wt ++V+++++ + +L++ +f+++ KIAA1617 821 EEERLVLES----NPLEWTVTDVVRFIK-LTDC--APLAK-IFQEQ- 858 dmsGkeLCslsk<-* d++G++L++l++ KIAA1617 859 DIDGQALLLLTL 870 PF07647.7.ls: domain 1 of 1, from 831 to 897: score 25.9, E = 0.00013 *->veswslesvaeWLesiglegqYkdnFsdqgitglellllrlteedLa + w++ +v + + ++ + + +F +q i+g ++l l lt+ + KIAA1617 831 PLEWTVTDVVRFIKLTDC-APLAKIFQEQDIDG-QAL-LLLTLPTV- 873 klalGitsvghRkkilkkiqelkqq<-* + ++ ++g+ k+ ++i+++k+ KIAA1617 874 Q-ECMELKLGPAIKLCHQIERVKVA 897 PF07647.7.fs: domain 1 of 1, from 831 to 897: score 23.9, E = 2.3e-06 *->veswslesvaeWLesiglegqYkdnFsdqgitglellllrlteedLa + w++ +v + + ++ + + +F +q i+g ++l l lt+ + KIAA1617 831 PLEWTVTDVVRFIKLTDC-APLAKIFQEQDIDG-QAL-LLLTLPTV- 873 klalGitsvghRkkilkkiqelkqq<-* + ++ ++g+ k+ ++i+++k+ KIAA1617 874 Q-ECMELKLGPAIKLCHQIERVKVA 897 PF00536.20.fs: domain 1 of 1, from 832 to 895: score 22.1, E = 6.9e-06 *->dgwsfesVgeWLesiglgqYidnFlsagyidgdtllqlteeDLed.l +w++ +V +++ +++ ++ F + + idg++ll+lt ++ + KIAA1617 832 LEWTVTDVVRFIKLTDCAPLAKIF-QEQDIDGQALLLLTLPTVQEcM 877 GvtllGHrkKIlssIqgLk<-* +l G++ K+++ I++ k KIAA1617 878 ELKL-GPAIKLCHQIERVK 895 PF00536.20.ls: domain 1 of 1, from 832 to 895: score 24.1, E = 0.00046 *->dgwsfesVgeWLesiglgqYidnFlsagyidgdtllqlteeDLed.l +w++ +V +++ +++ ++ F + + idg++ll+lt ++ + KIAA1617 832 LEWTVTDVVRFIKLTDCAPLAKIF-QEQDIDGQALLLLTLPTVQEcM 877 GvtllGHrkKIlssIqgLk<-* +l G++ K+++ I++ k KIAA1617 878 ELKL-GPAIKLCHQIERVK 895 //