hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-07182539/chunk_1/iprscan-20080502-07182539.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1595 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00490 98.5 8.1e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00490 1/1 152 234 .. 1 86 [] 98.5 8.1e-25 Alignments of top-scoring domains: SM00490: domain 1 of 1, from 152 to 234: score 98.5, E = 8.1e-25 *->delaelLkellkdpgikvarlHGglsqeeReeilekFrkgkikvLva + + L+ l+k g+k++++HG +++ +R +i+ +Frk + +Lv+ KIAA1595 152 EYYGKALEVLVK--GVKIMCIHG-KMKYKRNKIFMEFRKLQSGILVC 195 TdvaerGlDipgvdlVInydlpwspasyiQRiGRaGRaG<-* Tdv++rG+Dip+v++V +yd+p + + +++R GR++R+G KIAA1595 196 TDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIG 234 //