hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-06564019/chunk_1/iprscan-20080502-06564019.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1582
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00165                                                  33.0    4.1e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00165    1/1     990  1027 ..     1    38 []    33.0  4.1e-05

Alignments of top-scoring domains:
SM00165: domain 1 of 1, from 990 to 1027: score 33.0, E = 4.1e-05
                   *->deekieqLleMGFsreeavdALratngNverAaeyLls<-*
                       +  i+qL++MGF+re a++AL ++n+N++ A+  Ll+   
    KIAA1582   990    MSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLE    1027 

//