hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-05120805/chunk_1/iprscan-20080502-05120805.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1520
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00382                                                  67.8    1.4e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00382    1/1     575   761 ..     1    92 []    67.8  1.4e-15

Alignments of top-scoring domains:
SM00382: domain 1 of 1, from 575 to 761: score 67.8, E = 1.4e-15
                   *->pgevvllvGppGsGKTTlaralarllgp..gviyidge.........
                      pg+v++lvGp+GsGK+  ++ l ++++ ++g +++dg   +  +++ 
    KIAA1520   575    PGKVTALVGPSGSGKSSCVNILENFYPLegGRVLLDGKpisaydhky 621  

                   ..................................................
                    ++  +  +++     ++  ++ + +      +   +  ++ + ++   +
    KIAA1520   622 lhrvislvsqepvlfarsitdnisyglptvpfemvveaaqkanahgfime 671  

                   .................ggqrirlalalark...dvlllDEitslld...
                    +++ + + ++++ + +ggq++r+a+a+a  ++++vl+lDE+ts+ld ++
    KIAA1520   672 lqdgystetgekgaqlsGGQKQRVAMARALVrnpPVLILDEATSALDaes 721  

                   ..............vtviattndldpallrrrfdrrivllril<-*
                   + + ++  ++++++ tv+++++   ++ ++  +  ++vl++++   
    KIAA1520   722 eyliqqaihgnlqkHTVLIIAH---RLSTVEHAHLIVVLDKGR    761  

//