hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-05085298/chunk_1/iprscan-20080502-05085298.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1518 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00248 102.3 5.6e-26 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00248 1/5 691 721 .. 1 30 [] 26.2 0.0045 SM00248 2/5 725 758 .. 1 30 [] 5.7 8e+02 SM00248 3/5 763 792 .. 1 30 [] 32.4 6.3e-05 SM00248 4/5 796 826 .. 1 30 [] 23.8 0.024 SM00248 5/5 830 858 .. 1 30 [] 14.2 19 Alignments of top-scoring domains: SM00248: domain 1 of 5, from 691 to 721: score 26.2, E = 0.0045 *->dGrTpLHlAaengnlevvklLldkga.dina<-* +G+T+LH+ +++ n vv+ Lld+g+ +++ KIAA1518 691 NGNTALHYSVSHANFPVVQQLLDSGVcKVDK 721 SM00248: domain 2 of 5, from 725 to 758: score 5.7, E = 8e+02 *->dGrTpLHlAaen.....gnlevvklLldkgadina<-* G++p++l a + ++++++e+v L + g +ina KIAA1518 725 AGYSPIMLTALAtlktqDDIETVLQLFRLG-NINA 758 SM00248: domain 3 of 5, from 763 to 792: score 32.4, E = 6.3e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+T+L+lA+++g+++vvk+Ll ad+n+ KIAA1518 763 AGQTALMLAVSHGRVDVVKALLACEADVNV 792 SM00248: domain 4 of 5, from 796 to 826: score 23.8, E = 0.024 *->dGrTpLHlAaengnlevvklLldkga.dina<-* dG T+L++A+e+g++e++ lLl di + KIAA1518 796 DGSTALMCACEHGHKEIAGLLLAVPScDISL 826 SM00248: domain 5 of 5, from 830 to 858: score 14.2, E = 19 *->dGrTpLHlAaengnlevvklLldkgadina<-* dG T+L++A g+ e++ +L ++ +i + KIAA1518 830 DGSTALMVALDAGQSEIASMLYSRM-NIKC 858 //