hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03374765/chunk_1/iprscan-20080502-03374765.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1465 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00369 83.1 3.3e-20 5 SM00082 56.1 4.6e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00369 1/5 89 113 .. 1 24 [] 15.1 5.9 SM00369 2/5 114 137 .. 1 24 [] 8.9 34 SM00369 3/5 138 161 .. 1 24 [] 11.4 17 SM00369 4/5 162 185 .. 1 24 [] 19.9 0.37 SM00369 5/5 186 209 .. 1 24 [] 27.8 0.0015 SM00082 1/1 221 271 .. 1 55 [] 56.1 4.6e-12 Alignments of top-scoring domains: SM00369: domain 1 of 5, from 89 to 113: score 15.1, E = 5.9 *->LpnL.reLdLsnNqLtsLPpgaFqg<-* Lp+ ++L+Ls N++t L +gaF++ KIAA1465 89 LPANvTTLSLSANKITVLRRGAFAD 113 SM00369: domain 2 of 5, from 114 to 137: score 8.9, E = 34 *->LpnLreLdLsnNqLtsLPpgaFqg<-* ++ ++L L +N +++ pga++ KIAA1465 114 VTQVTSLWLAHNEVRTVEPGALAV 137 SM00369: domain 3 of 5, from 138 to 161: score 11.4, E = 17 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L+ LdLs+N ++s P +++ KIAA1465 138 LSQLKNLDLSHNFISSFPWSDLRN 161 SM00369: domain 4 of 5, from 162 to 185: score 19.9, E = 0.37 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L+ L ++N+L sLP++a++ KIAA1465 162 LSALQLLKMNHNRLGSLPRDALGA 185 SM00369: domain 5 of 5, from 186 to 209: score 27.8, E = 0.0015 *->LpnLreLdLsnNqLtsLPpgaFqg<-* Lp Lr+L+ +nN+L++L pg+F+ KIAA1465 186 LPDLRSLRINNNRLRTLAPGTFDA 209 SM00082: domain 1 of 1, from 221 to 271: score 56.1, E = 4.6e-12 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll NPf+C C+L wL+ w +++ l++p+ s+ CasP++l+G p+++l KIAA1465 221 NPFHCGCGLVWLQAWAAS-TRVSLPEPD-SIACASPPALQGVPVYRL 265 lpsefsCp<-* + +C KIAA1465 266 P--ALPCA 271 //