hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03311564/chunk_1/iprscan-20080502-03311564.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1461 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00391 27.3 0.00018 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00391 1/1 15 92 .. 1 87 [] 27.3 0.00018 Alignments of top-scoring domains: SM00391: domain 1 of 1, from 15 to 92: score 27.3, E = 0.00018 *->edelrlPa..LppGWrRetvqRksgKKssagkgDVyYisPcGkkLRs +e +lPa ++p GW R++ ++ V Y sP+G L+ KIAA1461 15 DKEGGLPAiqVPVGWQRRVD-----------QNGVLYVSPSGSLLSC 50 ksElarYLhkngdlslaledPLRPEYlFdFnarvpvgpkitp<-* +++ YL + g+++++le+PL F F+++ v + KIAA1461 51 LEQVKTYLLTDGTCKCGLECPLILPKVFNFDPGAAVKQRTAE 92 //