hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03005282/chunk_1/iprscan-20080502-03005282.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1443 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00389 49.9 3.4e-10 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00389 1/2 79 141 .. 1 63 [] 10.8 0.042 SM00389 2/2 380 442 .. 1 63 [] 39.0 6.2e-07 Alignments of top-scoring domains: SM00389: domain 1 of 2, from 79 to 141: score 10.8, E = 0.042 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv ++ + e L k F pYPs +++ L + gL+ + Vk+ KIAA1443 79 WTQAAQTSELDSNEHLLKTFSYFPYPSLADIALLCLRYGLQMEKVKT 125 WFQNRRakwkrqekkk<-* WF +R ++ ++ ++ KIAA1443 126 WFMAQRLRCGISWSSE 141 SM00389: domain 2 of 2, from 380 to 442: score 39.0, E = 6.2e-07 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv ++rk + t+eQl++L+ +F ++++ re+ ++L + +gL++ + KIAA1443 380 RQRKTKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQ 426 WFQNRRakwkrqekkk<-* WF R+ +k+ + k+ KIAA1443 427 WFGDTRYALKHGQLKW 442 //