hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-03005282/chunk_1/iprscan-20080502-03005282.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1443 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00046.19.ls Homeobox domain 1.4 0.0033 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00046.19.ls 1/1 383 437 .. 1 57 [] 1.4 0.0033 Alignments of top-scoring domains: PF00046.19.ls: domain 1 of 1, from 383 to 437: score 1.4, E = 0.0033 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW + kR t+eQl +L+ +F +++ re+ ++L + +gL+ + W KIAA1443 383 KTKR--KTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQW 427 FQNRRaKwKk<-* F R+ K KIAA1443 428 FGDTRYALKH 437 //