hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01560359/chunk_1/iprscan-20080502-01560359.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1406 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00182 41.0 5.8e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00182 1/1 249 397 .. 1 159 [] 41.0 5.8e-09 Alignments of top-scoring domains: SM00182: domain 1 of 1, from 249 to 397: score 41.0, E = 5.8e-09 *->dkvlvlFkYiedKDVFekyYkkhLAKRLllnrSaSdDaEenmitkLK d + +l++ + +KD+F ++Y+ +LA RLl++ S S++ E + ++ LK KIAA1406 249 DIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLK 295 qecGyPaefTsKLegMFrDislSkdltqsFkdylannpgnaskksiDlsn ++G + +e+M++D+ S+ ++ ++ + p +++ ++++ KIAA1406 296 LRFGE--APMHFCEVMLKDMADSRRINANIREEDEKRP---AEEQPPFGV 340 .vrVLtsgyWPtystekikveinLPqeLskaleeFeeFYlakhsGRkLtW + +L+s++WP ++ ++ P++ ++ale + + Y++ + R L+W KIAA1406 341 yAVILSSEFWPPFKD----EKLEVPEDIRAALEAYCKKYEQLKAMRTLSW 386 lhslgsgevkanf<-* h lg v++++ KIAA1406 387 KHTLG--LVTMDV 397 //