hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01473308/chunk_1/iprscan-20080502-01473308.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1401 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00785 126.1 3.9e-33 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00785 1/1 277 358 .. 1 89 [] 126.1 3.9e-33 Alignments of top-scoring domains: SM00785: domain 1 of 1, from 277 to 358: score 126.1, E = 3.9e-33 *->EilnLlRflsvmkprplsWRdqHpYlLadrveditnpeelieedpkv E+ LlR l+++k+++l++Rd+++Yl a v+++++ ee+++v KIAA1401 277 EAGMLLRQLANQKQQHLAFRDRRAYLFAHAVDFVPS-----EENNLV 318 drkklvvyGyVRGtgLnanrlVHIPGlGDFqiskIealpDPc<-* ++ l+++GyVRG+ Ln+nrl HI G+GDFq+++I+a+ DP+ KIAA1401 319 GT--LKISGYVRGQTLNVNRLLHIVGYGDFQMKQIDAPGDPF 358 //