hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01224493/chunk_1/iprscan-20080502-01224493.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1386 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01485.11.fs IBR domain 79.0 3.3e-24 2 PF01485.11.ls IBR domain 69.6 9.2e-18 1 PF00023.20.ls Ankyrin repeat 59.3 1.2e-14 2 PF00023.20.fs Ankyrin repeat 55.3 2e-14 2 PF02809.10.fs Ubiquitin interaction motif 17.5 0.0022 1 PF02809.10.ls Ubiquitin interaction motif 19.5 0.011 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00023.20.fs 1/2 170 202 .. 1 33 [] 22.2 3.3e-05 PF00023.20.ls 1/2 170 202 .. 1 33 [] 24.2 0.00043 PF00023.20.fs 2/2 269 301 .. 1 33 [] 33.1 3.1e-08 PF00023.20.ls 2/2 269 301 .. 1 33 [] 35.1 2.3e-07 PF01485.11.fs 1/2 527 603 .. 1 72 [] 67.6 1.2e-20 PF01485.11.ls 1/1 527 603 .. 1 72 [] 69.6 9.2e-18 PF01485.11.fs 2/2 643 677 .. 22 66 .. 11.4 0.0041 PF02809.10.ls 1/1 975 992 .. 1 18 [] 19.5 0.011 PF02809.10.fs 1/1 975 992 .. 1 18 [] 17.5 0.0022 Alignments of top-scoring domains: PF00023.20.fs: domain 1 of 2, from 170 to 202: score 22.2, E = 3.3e-05 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +TPLH+Aa++g +++ +l++ ++n ++ KIAA1386 170 QHNTPLHYAARHGMNKILGTFLGRDGNPNKRNV 202 PF00023.20.ls: domain 1 of 2, from 170 to 202: score 24.2, E = 0.00043 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +TPLH+Aa++g +++ +l++ ++n ++ KIAA1386 170 QHNTPLHYAARHGMNKILGTFLGRDGNPNKRNV 202 PF00023.20.fs: domain 2 of 2, from 269 to 301: score 33.1, E = 3.1e-08 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +TPLH+Aa +g + +v+lL+++G dl a + KIAA1386 269 KKNTPLHYAAASGMKACVELLVKHGGDLFAENE 301 PF00023.20.ls: domain 2 of 2, from 269 to 301: score 35.1, E = 2.3e-07 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* +TPLH+Aa +g + +v+lL+++G dl a + KIAA1386 269 KKNTPLHYAAASGMKACVELLVKHGGDLFAENE 301 PF01485.11.fs: domain 1 of 2, from 527 to 603: score 67.6, E = 1.2e-20 *->eKYerlllesyvesnkdlkwCPapdCsyivrvtdlss.g......sk ++Y ++ + +ve n+ kwCP p+C+++vr+t +s+ +++++ s KIAA1386 527 KRYLQFDIKAFVENNPAIKWCPTPGCDRAVRLTKQGSnTsgsdtlSF 573 eepssrrveCskGCgfeFCfnCkeewHgplsC<-* ++ ++ v C k g+ FC++C+ e+H+p++C KIAA1386 574 PLLRAPAVDCGK--GHLFCWECLGEAHEPCDC 603 PF01485.11.ls: domain 1 of 1, from 527 to 603: score 69.6, E = 9.2e-18 *->eKYerlllesyvesnkdlkwCPapdCsyivrvtdlss.g......sk ++Y ++ + +ve n+ kwCP p+C+++vr+t +s+ +++++ s KIAA1386 527 KRYLQFDIKAFVENNPAIKWCPTPGCDRAVRLTKQGSnTsgsdtlSF 573 eepssrrveCskGCgfeFCfnCkeewHgplsC<-* ++ ++ v C k g+ FC++C+ e+H+p++C KIAA1386 574 PLLRAPAVDCGK--GHLFCWECLGEAHEPCDC 603 PF01485.11.fs: domain 2 of 2, from 643 to 677: score 11.4, E = 0.0041 *->PapdCsyivrvtdlssgskeepssrrveCskGCgfeFCfnCkeew<- P ++C+++++++ +++ +C k C + FC+ C+eew KIAA1386 643 PCANCKSPIQKN---------EGCNHMQCAK-CKYDFCWICLEEW 677 * KIAA1386 - - PF02809.10.ls: domain 1 of 1, from 975 to 992: score 19.5, E = 0.011 *->mdEEedLqlALalSlqea<-* +++++++ lA++lSlqe+ KIAA1386 975 DEDDPNILLAIQLSLQES 992 PF02809.10.fs: domain 1 of 1, from 975 to 992: score 17.5, E = 0.0022 *->mdEEedLqlALalSlqea<-* +++++++ lA++lSlqe+ KIAA1386 975 DEDDPNILLAIQLSLQES 992 //