hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22484835/chunk_1/iprscan-20080501-22484835.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1294 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00295 145.4 6e-39 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00295 1/1 28 233 .. 1 232 [] 145.4 6e-39 Alignments of top-scoring domains: SM00295: domain 1 of 1, from 28 to 233: score 145.4, E = 6e-39 *->spkprvlkVylldgttlefevdssttaeelletvcrklglspresey + r++ V+lld+ le+ v+++ a+ell+ v+ +++l +e+ey KIAA1294 28 MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNL--KEKEY 72 FgLqfedkdedshWldpaktilkqdvkspksepltlyFRvkFyppdwhgp Fg++f+d++++ Wl++++ +l++d ks+p +lyF v+Fy++ KIAA1294 73 FGIAFTDETGHLNWLQLDRRVLEHDFP-KKSGPVVLYFCVRFYIES---- 117 peqlkeDptrynllylQvrddilsGrlpcpseeeallLAaLalqaefGdy + D+++++l++l +++ i ++ + + e ++LA+++lq Gd+ KIAA1294 118 -ISYLKDNATIELFFLNAKSCIYKELIDVD-SEVVFELASYILQEAKGDF 165 dpeeeekkkslkhvakelslkrflPkqlldsikasflqiqltlkewrerI +++ ++v+ +l lP q l+++ l + ++r+ KIAA1294 166 SSN--------EVVRSDLKKLPALPTQALKEHPS--------LAYCEDRV 199 velhkehaglspeeaklkYLelarrLpptYGvelF<-* e +k++ g+++ +a ++Y+ ++++Lp tYGv+++ KIAA1294 200 IEHYKKLNGQTRGQAIVNYMSIVESLP-TYGVHYY 233 //