hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080501/iprscan-20080501-22145577/chunk_1/iprscan-20080501-22145577.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1274
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00404                                                  20.3     0.0016   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00404    1/1     267   389 ..     1    92 []    20.3   0.0016

Alignments of top-scoring domains:
SM00404: domain 1 of 1, from 267 to 389: score 20.3, E = 0.0016
                   *->tvkhyhytgWpDhvekdsgvPe....dsileflravrk.........
                        ++yh +  p++     g P + + d++++ lr+  +  + ++ ++
    KIAA1274   267    PTYRYHRLPLPEQ-----GSPLeaqlDAFVSVLRETPSllqlrdahg 308  

                   ...PivVHCSAGvGRTGtfvaidillqq....................vd
                   +++ +v  C  GvGRT   +++ +l+ +++++++++++  +++ ++ ++ 
    KIAA1274   309 pppALVFSCQMGVGRTNLGMVLGTLILLhrsgttsqpeaaptqakplpME 358  

                   ifdtvkelRsqRpgmvqteeQYlFlyralle<-*
                    f++++++  + p+   + e+    + a++e   
    KIAA1274   359 QFQVIQSFLRMVPQGRRMVEEVDRAITACAE    389  

//