hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22065192/chunk_1/iprscan-20080501-22065192.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1269 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00258 156.4 3e-42 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00258 1/1 91 164 .. 1 76 [] 156.4 3e-42 Alignments of top-scoring domains: SM00258: domain 1 of 1, from 91 to 164: score 156.4, E = 3e-42 *->selPvtCGavkGiLykkkFkcPGirvkCIqvedegewlTPkEFeieg +++P+tCG+++++L+++kF+cPGi+vkC+q+++ ++++PkEF++++ KIAA1269 91 IVYPITCGDSRANLIWRKFVCPGINVKCVQYDE--HVISPKEFVHLA 135 gkgksKDWKrsIRcgGssLRtLmengtLd<-* gk++ KDWKr+IR++G++LR++m++g+Ld KIAA1269 136 GKSTLKDWKRAIRMNGIMLRKIMDSGELD 164 //