hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-22065192/chunk_1/iprscan-20080501-22065192.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1269 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01342.11.fs SAND domain 165.7 9.6e-48 1 PF01342.11.ls SAND domain 167.6 2.9e-47 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01342.11.fs 1/1 82 164 .. 1 86 [] 165.7 9.6e-48 PF01342.11.ls 1/1 82 164 .. 1 86 [] 167.6 2.9e-47 Alignments of top-scoring domains: PF01342.11.fs: domain 1 of 1, from 82 to 164: score 165.7, E = 9.6e-48 *->eenvdfkaselPqvTCGevkGiLykkkFksPGisvkCIqyedGkwlT ee+++++a++++++TCG+++++L+++kF++PGi+vkC+qy++ ++++ KIAA1269 82 EEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDE-HVIS 127 PkeFEiegGkgrsKDWKrsIRcgRSGssLreLmengtld<-* PkeF++++Gk+++KDWKr+IR++ G++Lr++m++g+ld KIAA1269 128 PKEFVHLAGKSTLKDWKRAIRMN--GIMLRKIMDSGELD 164 PF01342.11.ls: domain 1 of 1, from 82 to 164: score 167.6, E = 2.9e-47 *->eenvdfkaselPqvTCGevkGiLykkkFksPGisvkCIqyedGkwlT ee+++++a++++++TCG+++++L+++kF++PGi+vkC+qy++ ++++ KIAA1269 82 EEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDE-HVIS 127 PkeFEiegGkgrsKDWKrsIRcgRSGssLreLmengtld<-* PkeF++++Gk+++KDWKr+IR++ G++Lr++m++g+ld KIAA1269 128 PKEFVHLAGKSTLKDWKRAIRMN--GIMLRKIMDSGELD 164 //