hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-21250991/chunk_1/iprscan-20080501-21250991.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1244 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00222 213.4 1.9e-59 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00222 1/1 281 493 .. 1 226 [] 213.4 1.9e-59 Alignments of top-scoring domains: SM00222: domain 1 of 1, from 281 to 493: score 213.4, E = 1.9e-59 *->sknrkkllsegikkfnqkPkkGiqfLqekgflakevDdspqevAkfl s++++++ s++++++++++++++++++++++ a e+D+ + +v+++ KIAA1244 281 SYGSRYSESNFSVDDQDLSRTEFDSCDQYSMAA-EKDSGRSDVSDIG 326 ydseS.adadeseteglnkkaiGdyLgeshdefnrlvLhafvdlfdFsgk +d++S a ++e++ ++++G++ ++ + +l L ++++ +++s++ KIAA1244 327 SDNCSlA-----DEEQTPRDCLGHRSL--RTAALSLKLLKNQEADQHSAR 369 dldeALRefLesfrLPGEaQkIDRlleaFserYcecNpgvfskagkslsk ++++L +L +++ + +++D++l++F++++c +++++ ++g+s+++ KIAA1244 370 LFIQSLEGLLPRLLSLSNVEEVDTALQNFASTFCSGMMHSPGFDGNSSLS 419 iqqllnaDaaYvLaYSlIMLNTDLHnpnvkkskakdiLvKMtkedFikNl +q+l+naD+ Y++a++ ++LN++L + ++++ ++++L++ ++dF+k++ KIAA1244 420 FQMLMNADSLYTAAHCALLLNLKLSHGDYYR--KRPTLAPGVMKDFMKQV 467 rginkeiddgedlprefLeelYdsIknnei<-* + ++ +++ ++++++eelY+++ ++++ KIAA1244 468 QTSG----VLMVFSQAWIEELYHQVLDRNM 493 //