hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080501/iprscan-20080501-21232797/chunk_1/iprscan-20080501-21232797.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA1243
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00513                                                  44.2    1.7e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00513    1/1     129   163 ..     1    35 []    44.2  1.7e-08

Alignments of top-scoring domains:
SM00513: domain 1 of 1, from 129 to 163: score 44.2, E = 1.7e-08
                   *->lskLkVseLkdeLkkrGLstsGrKaeLvkRLleal<-*
                      l  LkVseLk eLk rGL++sG+K +L++RL+ +    
    KIAA1243   129    LDDLKVSELKTELKLRGLPVSGTKPDLIERLKPYQ    163  

//