hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-20150985/chunk_1/iprscan-20080501-20150985.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1204 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00620.17.fs RhoGAP domain 211.1 5.4e-62 1 PF00620.17.ls RhoGAP domain 213.0 6.1e-61 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00620.17.fs 1/1 36 188 .. 1 155 [] 211.1 5.4e-62 PF00620.17.ls 1/1 36 188 .. 1 155 [] 213.0 6.1e-61 Alignments of top-scoring domains: PF00620.17.fs: domain 1 of 1, from 36 to 188: score 211.1, E = 5.4e-62 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. P ++ +C ef+e +G ++GIyR+sG +s i++Lr++f ++ +dl+ KIAA1204 36 PYVLKSCAEFIETHG-IVDGIYRLSGVTSNIQRLRQEFGSDQCPDLt 81 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerle ++ +d+h v sl Kl++ReLP+PLlt+elye+f+e a+++ +ee +l KIAA1204 82 REVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTE-AVSHCPEEGQLA 130 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl +++ ++++LPp +++tL+yL++hL+++a++s++++M a+NLA+v++P+Ll KIAA1204 131 RIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLL 180 rppdgdsad<-* r+++ +a+ KIAA1204 181 RSKEI-EAT 188 PF00620.17.ls: domain 1 of 1, from 36 to 188: score 213.0, E = 6.1e-61 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. P ++ +C ef+e +G ++GIyR+sG +s i++Lr++f ++ +dl+ KIAA1204 36 PYVLKSCAEFIETHG-IVDGIYRLSGVTSNIQRLRQEFGSDQCPDLt 81 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerle ++ +d+h v sl Kl++ReLP+PLlt+elye+f+e a+++ +ee +l KIAA1204 82 REVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTE-AVSHCPEEGQLA 130 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl +++ ++++LPp +++tL+yL++hL+++a++s++++M a+NLA+v++P+Ll KIAA1204 131 RIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLL 180 rppdgdsad<-* r+++ +a+ KIAA1204 181 RSKEI-EAT 188 //