hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-18282836/chunk_1/iprscan-20080501-18282836.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1139 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00248 132.9 3.5e-35 5 SM00454 113.2 3e-29 2 SM00326 37.0 2.6e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00248 1/5 3 32 .. 1 30 [] 25.8 0.006 SM00248 2/5 36 65 .. 1 30 [] 30.4 0.00025 SM00248 3/5 69 98 .. 1 30 [] 16.1 5.1 SM00248 4/5 110 139 .. 1 30 [] 35.3 8.2e-06 SM00248 5/5 142 171 .. 1 30 [] 25.3 0.0085 SM00326 1/1 206 268 .. 1 58 [] 37.0 2.6e-06 SM00454 1/2 408 474 .. 1 67 [] 54.5 1.4e-11 SM00454 2/2 477 544 .. 1 67 [] 58.7 7.4e-13 Alignments of top-scoring domains: SM00248: domain 1 of 5, from 3 to 32: score 25.8, E = 0.006 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+ pLH+Aa g+le v+lLl+++a +na KIAA1139 3 NGMRPLHYAAWQGRLEPVRLLLRASAAVNA 32 SM00248: domain 2 of 5, from 36 to 65: score 30.4, E = 0.00025 *->dGrTpLHlAaengnlevvklLldkgadina<-* dG+ pLHlAa++g++ev ++Ll++ ++ + KIAA1139 36 DGQIPLHLAAQYGHYEVSEMLLQHQSNPCL 65 SM00248: domain 3 of 5, from 69 to 98: score 16.1, E = 5.1 *->dGrTpLHlAaengnlevvklLldkgadina<-* +TpL lA+e g+l+v++lLl++ + + KIAA1139 69 AKKTPLDLACEFGRLKVAQLLLNSHLCVAL 98 SM00248: domain 4 of 5, from 110 to 139: score 35.3, E = 8.2e-06 *->dGrTpLHlAaengnlevvklLldkgadina<-* + TpLHlAa+ng+ ev++ Ll++g +in KIAA1139 110 NYTTPLHLAAKNGHREVIRQLLRAGIEINR 139 SM00248: domain 5 of 5, from 142 to 171: score 25.3, E = 0.0085 *->dGrTpLHlAaengnlevvklLldkgadina<-* T+LH Aa +g evv+lLl+ g+d+n+ KIAA1139 142 KTGTALHEAALYGKTEVVRLLLEGGVDVNI 171 SM00326: domain 1 of 1, from 206 to 268: score 37.0, E = 2.6e-06 *->eyvvAlYDyea.qnedELsFkkGDiitvleksddgWweGelnr.... +v+Al D+ ++ L +++GD+itvle++ dg w+G ++ ++++ KIAA1139 206 LKVRALKDFWNlHDPTALNVRAGDVITVLEQHPDGRWKGHIHEsqrg 252 tGkeGlfPsnYVeeie<-* t ++G+fP Ve++ KIAA1139 253 TDRIGYFPPGIVEVVS 268 SM00454: domain 1 of 2, from 408 to 474: score 54.5, E = 1.4e-11 *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel ++ + + +WL +le Y+ +F+++g+d ++t edL+ + KIAA1139 408 LEgKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMT-PEDLTAI 453 GitllGhRkkIlsaiqklkeq<-* G+t++GhRkkI+s+i +l KIAA1139 454 GVTKPGHRKKIASEIAQLSIA 474 SM00454: domain 2 of 2, from 477 to 544: score 58.7, E = 7.4e-13 *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel ++ p ++ eWL ++gl+qY +++ + g+d++ l++ ++ e L+e+ KIAA1139 477 LPsYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI 523 GitllGhRkkIlsaiqklkeq<-* G+++lGh+kk++ +++ l e KIAA1139 524 GVNKLGHQKKLMLGVKRLAEL 544 //