hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-17011132/chunk_1/iprscan-20080501-17011132.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1087 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00237 351.1 7.2e-101 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00237 1/2 415 514 .. 1 106 [] 172.5 4.1e-47 SM00237 2/2 543 643 .. 1 106 [] 178.6 6.1e-49 Alignments of top-scoring domains: SM00237: domain 1 of 2, from 415 to 514: score 172.5, E = 4.1e-47 *->atvtilDddhagtvgFeqphytVsEsdGevevtVvRtggtargtvvV + ++ Dd a++++Fe++ y+++E++G+v + V+++gg+ ++t++V KIAA1087 415 GAGEDEDDG-ASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYV 460 pyrTedGTAtaGgsDYepvdIeGtLtFepgegtekeIrikiidDdiyEer +yrTedG+A+aG sDYe+ eGtL+F+pge t+ke+ri+iidDdi+Ee KIAA1087 461 DYRTEDGSAKAG-SDYEYS--EGTLVFKPGE-TQKELRIGIIDDDIFEE- 505 dEtFyvrLs<-* dE+F+vrL+ KIAA1087 506 DEHFFVRLL 514 SM00237: domain 2 of 2, from 543 to 643: score 178.6, E = 6.1e-49 *->atvtilDddhagtvgFeqphytVsEsdGevevtVvRtggtargtvvV atvtilDddhag+++F++ +VsE++G+v+v+VvR++g argtv+ KIAA1087 543 ATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSG-ARGTVRL 588 pyrTedGTAtaGgsDYepvdIeGtLtFepgegtekeIrikiidDdiyEer pyrT+dGTA++Gg++Ye++ +G+L+F+++e t+k++++ki+dD++yE+ KIAA1087 589 PYRTVDGTARGGGVHYEDA--CGELEFGDDE-TMKTLQVKIVDDEEYEK- 634 dEtFyvrLs<-* ++F+++L+ KIAA1087 635 KDNFFIELG 643 //