hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16390925/chunk_1/iprscan-20080501-16390925.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1074 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00248 110.7 1.7e-28 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00248 1/4 85 114 .. 1 30 [] 32.2 7e-05 SM00248 2/4 118 147 .. 1 30 [] 24.3 0.017 SM00248 3/4 151 180 .. 1 30 [] 28.9 0.00068 SM00248 4/4 184 213 .. 1 30 [] 25.2 0.0089 Alignments of top-scoring domains: SM00248: domain 1 of 4, from 85 to 114: score 32.2, E = 7e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* +rT+LHlA++ng++evv lL+d++ +n+ KIAA1074 85 MNRTALHLACANGHPEVVTLLVDRKCQLNV 114 SM00248: domain 2 of 4, from 118 to 147: score 24.3, E = 0.017 *->dGrTpLHlAaengnlevvklLldkgadina<-* ++rT+L+ A++ ++++ +Ll++gad+n+ KIAA1074 118 ENRTALMKAVQCQEEKCATILLEHGADPNL 147 SM00248: domain 3 of 4, from 151 to 180: score 28.9, E = 0.00068 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G+T+LH+A++n +++v+ Ll ++a+i+a KIAA1074 151 HGNTALHYAVYNEDISVATKLLLYDANIEA 180 SM00248: domain 4 of 4, from 184 to 213: score 25.2, E = 0.0089 *->dGrTpLHlAaengnlevvklLldkgadina<-* d+ TpL lA++ + +v++L++k+a++na KIAA1074 184 DDLTPLLLAVSGKKQQMVEFLIKKKANVNA 213 //