hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16291892/chunk_1/iprscan-20080501-16291892.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1068 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04969.6.fs CS domain 85.9 1.2e-24 1 PF04969.6.ls CS domain 87.8 3e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04969.6.fs 1/1 181 260 .. 1 83 [] 85.9 1.2e-24 PF04969.6.ls 1/1 181 260 .. 1 83 [] 87.8 3e-23 Alignments of top-scoring domains: PF04969.6.fs: domain 1 of 1, from 181 to 260: score 85.9, E = 1.2e-24 *->prydWyQtldeVtitiplkgvfpikkkdvkVeikpkslkvsikgpgg ++y+W+Q +++++++p+++ ++k+k+v+V ++++s++v + ++g KIAA1068 181 ENYTWSQDYTDLEVRVPVPKH-VVKGKQVSVALSSSSIRVAMLEENG 226 dkpylldgepLfgpIdpeeSswkiedtkkveItLkK<-* +++l++g+ L ++I++e S w++e++k+v + L K KIAA1068 227 -ERVLMEGK-LTHKINTESSLWSLEPGKCVLVNLSK 260 PF04969.6.ls: domain 1 of 1, from 181 to 260: score 87.8, E = 3e-23 *->prydWyQtldeVtitiplkgvfpikkkdvkVeikpkslkvsikgpgg ++y+W+Q +++++++p+++ ++k+k+v+V ++++s++v + ++g KIAA1068 181 ENYTWSQDYTDLEVRVPVPKH-VVKGKQVSVALSSSSIRVAMLEENG 226 dkpylldgepLfgpIdpeeSswkiedtkkveItLkK<-* +++l++g+ L ++I++e S w++e++k+v + L K KIAA1068 227 -ERVLMEGK-LTHKINTESSLWSLEPGKCVLVNLSK 260 //