hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16241359/chunk_1/iprscan-20080501-16241359.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1065 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00273 234.2 1.1e-65 1 SM00726 33.5 2.8e-05 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00273 1/1 42 168 .. 1 137 [] 234.2 1.1e-65 SM00726 1/2 299 318 .. 1 20 [] 19.4 0.51 SM00726 2/2 324 343 .. 1 20 [] 14.1 19 Alignments of top-scoring domains: SM00273: domain 1 of 1, from 42 to 168: score 234.2, E = 1.1e-65 *->sdlevkVrkATnndewgpkgkhlreIlqgTsneklrssfaeimavlw s++e+kVr+AT+nd+wgp+++++ eI+++T+n+ ++f eim+++w KIAA1065 42 SEAEIKVREATSNDPWGPSSSLMTEIADLTYNV---VAFSEIMSMVW 85 rRLndkgknWrvvyKaLillhyLlrnGspfervvlealrnrnrIltLsdf +RLnd+gknWr+vyKaL+ll+yL++ Gs erv +++++n+ I+tL+df KIAA1065 86 KRLNDHGKNWRHVYKALTLLDYLIKTGS--ERVAQQCRENIFAIQTLKDF 133 qdkvfndidsrgkDqGaniRtyakyLlelledderlkeer<-* q+ id++gkDqG+n+R+++k+L++ll+d+erlk+er KIAA1065 134 QY-----IDRDGKDQGINVREKSKQLVALLKDEERLKAER 168 SM00726: domain 1 of 2, from 299 to 318: score 19.4, E = 0.51 *->dEdedLqlAlelSlqeaeee<-* +E+ +LqlAl++S++ ae+e KIAA1065 299 EEELQLQLALAMSREVAEQE 318 SM00726: domain 2 of 2, from 324 to 343: score 14.1, E = 19 *->dEdedLqlAlelSlqeaeee<-* +d Lq+Ale+S+++ + KIAA1065 324 GDDLRLQMALEESRRDTVKI 343 //