hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16021699/chunk_1/iprscan-20080501-16021699.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA1052 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00397.16.fs WW domain 26.3 2.1e-06 1 PF00397.16.ls WW domain 28.3 2.5e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00397.16.fs 1/1 59 88 .. 1 30 [] 26.3 2.1e-06 PF00397.16.ls 1/1 59 88 .. 1 30 [] 28.3 2.5e-05 Alignments of top-scoring domains: PF00397.16.fs: domain 1 of 1, from 59 to 88: score 26.3, E = 2.1e-06 *->lppgWeertdpdGrpYYyNhnTktTqWekP<-* lp W+ d G +YY+N ++++ W++P KIAA1052 59 LPGEWKPCQDITGDIYYFNFANGQSMWDHP 88 PF00397.16.ls: domain 1 of 1, from 59 to 88: score 28.3, E = 2.5e-05 *->lppgWeertdpdGrpYYyNhnTktTqWekP<-* lp W+ d G +YY+N ++++ W++P KIAA1052 59 LPGEWKPCQDITGDIYYFNFANGQSMWDHP 88 //