hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-17505612/chunk_1/iprscan-20080502-17505612.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0955 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00619.12.ls Caspase recruitment domain 94.5 2.9e-25 1 PF00619.12.fs Caspase recruitment domain 92.5 5.2e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00619.12.fs 1/1 399 483 .. 1 89 [] 92.5 5.2e-25 PF00619.12.ls 1/1 399 483 .. 1 89 [] 94.5 2.9e-25 Alignments of top-scoring domains: PF00619.12.fs: domain 1 of 1, from 399 to 483: score 92.5, E = 5.2e-25 *->rellrknRvaLvrrlgketldglLDyLleknVLteeeyEeIkaantt +++++n+++L++r+g +l+g+LD+L ++VLte+e E++ + ++t KIAA0955 399 AAFVKENHRQLQARMG--DLKGVLDDLQDNEVLTENEKELVEQ-EKT 442 rrdkareLldlvqkkGpeafqiFleaLretgqphLadllels<-* r++k+++Ll++v+kkG+ a++++++++ e +p+L+++l+++ KIAA0955 443 RQSKNEALLSMVEKKGDLALDVLFRSISE-RDPYLVSYLRQQ 483 PF00619.12.ls: domain 1 of 1, from 399 to 483: score 94.5, E = 2.9e-25 *->rellrknRvaLvrrlgketldglLDyLleknVLteeeyEeIkaantt +++++n+++L++r+g +l+g+LD+L ++VLte+e E++ + ++t KIAA0955 399 AAFVKENHRQLQARMG--DLKGVLDDLQDNEVLTENEKELVEQ-EKT 442 rrdkareLldlvqkkGpeafqiFleaLretgqphLadllels<-* r++k+++Ll++v+kkG+ a++++++++ e +p+L+++l+++ KIAA0955 443 RQSKNEALLSMVEKKGDLALDVLFRSISE-RDPYLVSYLRQQ 483 //