hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-15540628/chunk_1/iprscan-20080502-15540628.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0887 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00627.21.fs UBA/TS-N domain 20.9 3.4e-05 1 PF00789.11.fs UBX domain 17.9 0.00021 2 PF00789.11.ls UBX domain 18.4 0.0013 1 PF00627.21.ls UBA/TS-N domain 20.8 0.0046 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00627.21.fs 1/1 10 46 .. 1 36 [. 20.9 3.4e-05 PF00627.21.ls 1/1 10 51 .. 1 41 [] 20.8 0.0046 PF00789.11.ls 1/1 354 439 .. 1 92 [] 18.4 0.0013 Alignments of top-scoring domains: PF00627.21.fs: domain 1 of 1, from 10 to 46: score 20.9, E = 3.4e-05 *->ideeavkqLreMTGf.dreeakkALeatngnverAve<-* ++ e++ q +++TG +++++++ Le++n+n+e+Av+ KIAA0887 10 EQTEKLLQFQDLTGIeSMDQCRHTLEQHNWNIEAAVQ 46 PF00627.21.ls: domain 1 of 1, from 10 to 51: score 20.8, E = 0.0046 *->ideeavkqLreMTGf.dreeakkALeatngnverAvewLleh<-* ++ e++ q +++TG +++++++ Le++n+n+e+Av+ l++ KIAA0887 10 EQTEKLLQFQDLTGIeSMDQCRHTLEQHNWNIEAAVQDRLNE 51 PF00789.11.ls: domain 1 of 1, from 354 to 439: score 18.4, E = 0.0013 *->skaedvcrlqiRlPDGsrlvrrFnssdklqdvydfVdsnrddadepe ++++ +++ ++lP+ sr +rrF s +l + df++s + ++ KIAA0887 354 PDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEK-- 398 VyPdYHdyeFsLltnfPRrlltdddesk.....tLkeagllpnstlvlep F++ nfPRr+l + + ++++tL+eagl ++l+++ KIAA0887 399 ---------FQIEANFPRRVLPCIPSEEwpnppTLQEAGLSHTEVLFVQD 439 <-* KIAA0887 - - //