hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-15334965/chunk_1/iprscan-20080502-15334965.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0875 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR02097 yccV: hemimethylated DNA binding domain 193.9 1.2e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR02097 1/1 493 590 .. 1 103 [] 193.9 1.2e-55 Alignments of top-scoring domains: TIGR02097: domain 1 of 1, from 493 to 590: score 193.9, E = 1.2e-55 *->aakFriGqvvRHklfgyrGVVidvDPeyanteewleaipveirprGk +++++iG++++Hk++gy++V++++DP++++++ew+++++v+++p+G+ KIAA0875 493 DVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGH 539 dQPFYhVLvEddegeplyvaYvaEeNLlsdesdepiehPqvdelFdkfde +QPFY+VLvEd++++ Y+a+eNL++++++++i+hP+v+++F++f++ KIAA0875 540 HQPFYNVLVEDGSCR-----YAAQENLEYNVEPQEISHPDVGRYFSEFTG 584 glykpk<-* ++y+p+ KIAA0875 585 THYIPN 590 //