hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-15064721/chunk_1/iprscan-20080502-15064721.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0859 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08241.2.fs Methyltransferase domain 53.6 7.8e-14 2 PF08241.2.ls Methyltransferase domain 43.2 8.3e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08241.2.fs 1/2 61 166 .. 1 99 [] 41.2 1.7e-10 PF08241.2.ls 1/1 61 166 .. 1 99 [] 43.2 8.3e-10 Alignments of top-scoring domains: PF08241.2.fs: domain 1 of 2, from 61 to 166: score 41.2, E = 1.7e-10 *->LDvGcGtGllaraLarrvgpgarvtGvDlspemlalArerapragle L +GcG+ l+++L + + +++ +D+s+ +++ +e ++ + ++ KIAA0859 61 LVIGCGNSELSEQLYDV--GYRDIVNIDISEVVIKQMKECNATRRPQ 105 n.fvvgDaedLPfpDesFDlVvsslvlhhl........aedperalrEia +f+++D++++ fpD+sF +V+ ++l + +++++++ + ++r l+E+ KIAA0859 106 MsFLKMDMTQMEFPDASFQVVLDKGTLDAVltdeeektLQQVDRMLAEVG 155 RVLKPGGklvi<-* RVL GG+ ++ KIAA0859 156 RVLQVGGRYLC 166 PF08241.2.ls: domain 1 of 1, from 61 to 166: score 43.2, E = 8.3e-10 *->LDvGcGtGllaraLarrvgpgarvtGvDlspemlalArerapragle L +GcG+ l+++L + + +++ +D+s+ +++ +e ++ + ++ KIAA0859 61 LVIGCGNSELSEQLYDV--GYRDIVNIDISEVVIKQMKECNATRRPQ 105 n.fvvgDaedLPfpDesFDlVvsslvlhhl........aedperalrEia +f+++D++++ fpD+sF +V+ ++l + +++++++ + ++r l+E+ KIAA0859 106 MsFLKMDMTQMEFPDASFQVVLDKGTLDAVltdeeektLQQVDRMLAEVG 155 RVLKPGGklvi<-* RVL GG+ ++ KIAA0859 156 RVLQVGGRYLC 166 //