hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-13143743/chunk_1/iprscan-20080502-13143743.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0794 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00789.11.ls UBX domain 113.3 6.5e-31 1 PF00789.11.fs UBX domain 111.4 7.6e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02809.10.fs 1/1 285 302 .. 1 18 [] 12.0 0.066 PF02809.10.ls 1/1 285 302 .. 1 18 [] 14.0 0.33 PF00789.11.fs 1/1 408 488 .. 1 92 [] 111.4 7.6e-31 PF00789.11.ls 1/1 408 488 .. 1 92 [] 113.3 6.5e-31 Alignments of top-scoring domains: PF02809.10.fs: domain 1 of 1, from 285 to 302: score 12.0, E = 0.066 *->mdEEedLqlALalSlqea<-* +E+ +L+ A++ Slqe KIAA0794 285 ASEDSQLEAAIRASLQET 302 PF02809.10.ls: domain 1 of 1, from 285 to 302: score 14.0, E = 0.33 *->mdEEedLqlALalSlqea<-* +E+ +L+ A++ Slqe KIAA0794 285 ASEDSQLEAAIRASLQET 302 PF00789.11.fs: domain 1 of 1, from 408 to 488: score 111.4, E = 7.6e-31 *->skaedvcrlqiRlPDGsrlvrrFnssdklqdvydfVdsnrddadepe ++++++++l++R+PDG+r++++ + ++kl +++++V+s++++++ KIAA0794 408 DVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNER-- 452 VyPdYHdyeFsLltnfPRrlltdddesktLkeagllpnstlvlep<-* F+LltnfPRr l+++d++ tL+eagl+p++t+++++ KIAA0794 453 ---------FELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQE 488 PF00789.11.ls: domain 1 of 1, from 408 to 488: score 113.3, E = 6.5e-31 *->skaedvcrlqiRlPDGsrlvrrFnssdklqdvydfVdsnrddadepe ++++++++l++R+PDG+r++++ + ++kl +++++V+s++++++ KIAA0794 408 DVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNER-- 452 VyPdYHdyeFsLltnfPRrlltdddesktLkeagllpnstlvlep<-* F+LltnfPRr l+++d++ tL+eagl+p++t+++++ KIAA0794 453 ---------FELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQE 488 //