hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12354033/chunk_1/iprscan-20080502-12354033.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0771 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00326 74.1 1.7e-17 1 SM00248 70.8 1.7e-16 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00248 1/2 778 807 .. 1 30 [] 38.8 7.1e-07 SM00248 2/2 811 840 .. 1 30 [] 32.0 8.2e-05 SM00326 1/1 880 938 .. 1 58 [] 74.1 1.7e-17 Alignments of top-scoring domains: SM00248: domain 1 of 2, from 778 to 807: score 38.8, E = 7.1e-07 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G TpLH A++ g++++vk+Lld g+++na KIAA0771 778 EGITPLHNAVCAGHHHIVKFLLDFGVNVNA 807 SM00248: domain 2 of 2, from 811 to 840: score 32.0, E = 8.2e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* dG+TpLH+Aa+ ++++++k L+++ga i a KIAA0771 811 DGWTPLHCAASCNSVHLCKQLVESGAAIFA 840 SM00326: domain 1 of 1, from 880 to 938: score 74.1, E = 1.7e-17 *->eyvvAlYDyeaqnedELsFkkGDiitvleks...ddgWweGelnrtG +++ Al+Dyeaqn+dELsF++GD +t+l++ ++++ +Ww+++l+ KIAA0771 880 GVAYALWDYEAQNSDELSFHEGDALTILRRKdesETEWWWARLG--D 924 keGlfPsnYVeeie<-* +eG++P+n + +++ KIAA0771 925 REGYVPKNLLGLYP 938 //