hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12252390/chunk_1/iprscan-20080502-12252390.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0765 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 104.9 2.2e-28 3 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 99.1 5e-27 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/3 452 522 .. 1 74 [] 35.3 3.9e-09 PF00076.12.ls 1/3 452 522 .. 1 74 [] 37.2 5.3e-08 PF00076.12.fs 2/3 566 636 .. 1 74 [] 30.5 8.4e-08 PF00076.12.ls 2/3 566 636 .. 1 74 [] 32.5 1.4e-06 PF00076.12.fs 3/3 878 949 .. 1 74 [] 33.3 1.4e-08 PF00076.12.ls 3/3 878 949 .. 1 74 [] 35.2 2.1e-07 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 3, from 452 to 522: score 35.3, E = 3.9e-09 *->lfVgNLppdtteedLkdlFskfGpi.esikivrDttretgrskGfaF ++ ++Lp+++ + + d+F+k ++ si i + +g+ G +F KIAA0765 452 VYLKGLPFEAENKHVIDFFKKLDIVeDSIYIAYG---PNGKATGEGF 495 VeFedeedAekAldalnGkelggrelrv<-* VeF +e d ++Al ++++ g+r + v KIAA0765 496 VEFRNEADYKAALC-RHKQYMGNRFIQV 522 PF00076.12.ls: domain 1 of 3, from 452 to 522: score 37.2, E = 5.3e-08 *->lfVgNLppdtteedLkdlFskfGpi.esikivrDttretgrskGfaF ++ ++Lp+++ + + d+F+k ++ si i + +g+ G +F KIAA0765 452 VYLKGLPFEAENKHVIDFFKKLDIVeDSIYIAYG---PNGKATGEGF 495 VeFedeedAekAldalnGkelggrelrv<-* VeF +e d ++Al ++++ g+r + v KIAA0765 496 VEFRNEADYKAALC-RHKQYMGNRFIQV 522 PF00076.12.fs: domain 2 of 3, from 566 to 636: score 30.5, E = 8.4e-08 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV ++N+p+++t+ d+ ++ + ++ e++ v ++g+ G a V KIAA0765 566 AHITNIPFSITKMDVLQFLEGIPVDENAVHVLV--DNNGQGLGQALV 610 eFedeedAekAldalnGkelggrelrv<-* +F++e+dA+k + l+ k+l+gre v KIAA0765 611 QFKNEDDARKSER-LHRKKLNGREAFV 636 PF00076.12.ls: domain 2 of 3, from 566 to 636: score 32.5, E = 1.4e-06 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV ++N+p+++t+ d+ ++ + ++ e++ v ++g+ G a V KIAA0765 566 AHITNIPFSITKMDVLQFLEGIPVDENAVHVLV--DNNGQGLGQALV 610 eFedeedAekAldalnGkelggrelrv<-* +F++e+dA+k + l+ k+l+gre v KIAA0765 611 QFKNEDDARKSER-LHRKKLNGREAFV 636 PF00076.12.fs: domain 3 of 3, from 878 to 949: score 33.3, E = 1.4e-08 *->lfVgNLppdtteedLkdlFskfGpi.esikivrDttretgrskGfaF + V N p+ ++ +++ d+F + i+ s+ ++++ e+g + G a KIAA0765 878 IKVQNMPFTVSIDEILDFFYGYQVIpGSVCLKYN---EKGMPTGEAM 921 VeFedeedAekAldalnGkelggrelrv<-* V Fe+ ++A++A+ ln + +g+r+++ KIAA0765 922 VAFESRDEATAAVIDLNDRPIGSRKVKL 949 PF00076.12.ls: domain 3 of 3, from 878 to 949: score 35.2, E = 2.1e-07 *->lfVgNLppdtteedLkdlFskfGpi.esikivrDttretgrskGfaF + V N p+ ++ +++ d+F + i+ s+ ++++ e+g + G a KIAA0765 878 IKVQNMPFTVSIDEILDFFYGYQVIpGSVCLKYN---EKGMPTGEAM 921 VeFedeedAekAldalnGkelggrelrv<-* V Fe+ ++A++A+ ln + +g+r+++ KIAA0765 922 VAFESRDEATAAVIDLNDRPIGSRKVKL 949 //