hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11455127/chunk_1/iprscan-20080502-11455127.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0742 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00558 201.8 6.1e-56 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00558 1/1 1075 1298 .. 1 214 [] 201.8 6.1e-56 Alignments of top-scoring domains: SM00558: domain 1 of 1, from 1075 to 1298: score 201.8, E = 6.1e-56 *->lylqqlwnlaklPffeytdpkpksgklnllsdlpkerywedilgpdv +++++ +++a++P++eyt ++ gklnl+s lp +++ pd+ KIAA0742 1075 MPSRFDDLMANIPLPEYTRRD---GKLNLASRLP-----NYFVRPDL 1113 gkPkpkpylymGma.E.sr.gstTpwHiDdydlySvNylhqgage..... g pk+y ++G + ++r+ +tT++H+D++d + N++++++ ++++ + KIAA0742 1114 G---PKMYNAYGLItPeDRkYGTTNLHLDVSD--AANVMVYVGIPkgqce 1158 ...........................d.GKrWyliPpedaeklekllkk ++++ ++ +++++++ + ++ ++++++G++W++ + +d ek++++lkk KIAA0742 1159 qeeevlktiqdgdsdeltikrfiegkeKpGALWHIYAAKDTEKIREFLKK 1208 hgkef.hi.stapdlfkeqpdllihlstwispevlkkrlkeeperPlfqg ++e++++++ ++++ih+++w+++ l+krl e+ g KIAA0742 1209 VSEEQgQEnP--------ADHDPIHDQSWYLDRSLRKRLHQEY------G 1244 vpvyrfvQkpGefvfiPpGwyHaVfnlGkfniavavNFaspewlpmglrl v+ + +vQ +G++vfiP+G++H+V nl +++i+va +F+spe++ +++ l KIAA0742 1245 VQGWAIVQFLGDVVFIPAGAPHQVHNL-YSCIKVAEDFVSPEHVKHCFWL 1293 veelr<-* ++e+r KIAA0742 1294 TQEFR 1298 //