hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11305313/chunk_1/iprscan-20080502-11305313.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0733 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00546 51.2 1.3e-10 1 SM00547 40.5 2.3e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00546 1/1 13 55 .. 1 43 [] 51.2 1.3e-10 SM00547 1/1 671 695 .. 1 25 [] 40.5 2.3e-07 Alignments of top-scoring domains: SM00546: domain 1 of 1, from 13 to 55: score 51.2, E = 1.3e-10 *->eneealsqlkemFPnldeevIeavLeantgnveatinnLLegs<-* + ++l++l++ FP+++e+v+++++++n++n++a++++L ++s KIAA0733 13 IDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES 55 SM00547: domain 1 of 1, from 671 to 695: score 40.5, E = 2.3e-07 *->gdWeCpaCtflNfasrskCfaCgap<-* +W+C+aCtflN++ ++C++C+ p KIAA0733 671 AQWNCTACTFLNHPALIRCEQCEMP 695 //