hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11253967/chunk_1/iprscan-20080502-11253967.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0730 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00748 102.8 3.9e-26 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00748 1/1 876 992 .. 1 123 [] 102.8 3.9e-26 Alignments of top-scoring domains: SM00748: domain 1 of 1, from 876 to 992: score 102.8, E = 3.9e-26 *->lrrAkrflevAkldlekGrYdlAcFlsqQAaElaLKalLilklggep lr+A++++++A++dl+k+ +++cF++ + laL a ++++g++ KIAA0730 876 LRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAAD-YAVRGKS 921 pkTHslreLlrllkkllellekipelseeirecleeLeeaYikSRYPDay k ++L+++++++ + l e + + ++ le +k+RYPD + KIAA0730 922 DKDVKPTALAQKIEEYSQQL----EGLTNDVHTLEAYGVDSLKTRYPDLL 967 pegeyipleeytkedAEellkcaekv<-* p+ + ip +++t e+A++ ++c ++ KIAA0730 968 PFPQ-IPNDRFTSEVAMRVMECTACI 992 //