hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-11253967/chunk_1/iprscan-20080502-11253967.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0730 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF05168.4.fs HEPN domain 26.7 5.6e-07 1 PF05168.4.ls HEPN domain 20.2 5.6e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF05168.4.fs 1/1 872 912 .. 1 41 [. 26.7 5.6e-07 PF05168.4.ls 1/1 872 999 .. 1 134 [] 20.2 5.6e-05 Alignments of top-scoring domains: PF05168.4.fs: domain 1 of 1, from 872 to 912: score 26.7, E = 5.6e-07 *->aedwlrrAerdLeaAellleegdYdwacFhaqQAaEkalKA<-* a++wlr+A+ ++ aA+++l+ + +w+cF ++ + +al A KIAA0730 872 ARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIA 912 PF05168.4.ls: domain 1 of 1, from 872 to 999: score 20.2, E = 5.6e-05 *->aedwlrrAerdLeaAellleegdYdwacFhaqQAaEkalKAlLlklg a++wlr+A+ ++ aA+++l+ + +w+cF ++ + +al A ++ KIAA0730 872 ARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVR 918 geppktHslreLlgeellkellgedlikelpeelreelreLdkayi...p g k ++L+ +++e+ ++ e l + L+ + +++ + KIAA0730 919 GKSDKDVKPTALAQ--KIEEYSQQ------LEGLTNDVHTLEAYGVdslK 960 sRYpdaeeegyppyeyYteedAeealkiAeevlefivekl<-* +RYpd +++ p + +t e A + +++ ++ +e+ KIAA0730 961 TRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIK-LENF 999 //