hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-10341895/chunk_1/iprscan-20080502-10341895.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0700 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00761 220.7 1.3e-61 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00761 1/1 400 500 .. 1 103 [] 220.7 1.3e-61 Alignments of top-scoring domains: SM00761: domain 1 of 1, from 400 to 500: score 220.7, E = 1.3e-61 *->nCkrlGPSYRlLPksekqpkCSGRdeLcDkeVLNDtWVShPtwaSED +Ckr+G+SYR+LPk ++qpkCSGR+++c keVLNDtWVS+P+w+ ED KIAA0700 400 SCKRIGSSYRALPKTYQQPKCSGRTAIC-KEVLNDTWVSFPSWS-ED 444 sgFvahrKNqYEEaLfrcEDERfElDmviEsnsstIklLeeilnkisdms s+Fv+++K++YEE L+rcEDERfElD+v+E+n++tI++Le +++k+s+m KIAA0700 445 STFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMA 494 deeran<-* +e++++ KIAA0700 495 PEDQEK 500 //