hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-09450011/chunk_1/iprscan-20080502-09450011.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0671 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00253 80.0 2.9e-19 1 SM00252 75.2 7.8e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00252 1/1 380 466 .. 1 87 [] 75.2 7.8e-18 SM00253 1/1 476 519 .. 1 46 [] 80.0 2.9e-19 Alignments of top-scoring domains: SM00252: domain 1 of 1, from 380 to 466: score 75.2, E = 7.8e-18 *->epWYHGkisReeAEklLkneggpdGtFLvRdSesspgdyvLSvrvkg p+Y+G ++R eAE+lL + +p+GtFL+RdS ++ + +++S+r + KIAA0671 380 NPCYWGVMDRYEAEALLEG--KPEGTFLLRDSAQEDYLFSVSFRRYN 424 kvkHyrIrrtddgkfylggtprrkFps..L.eLvehYqknslg<-* + H rI++ + f+++ +++ F+s++++ L+ehY+ +s KIAA0671 425 RSLHARIEQWN-HNFSFDAHDPCVFHSstVtGLLEHYKDPSSC 466 SM00253: domain 1 of 1, from 476 to 519: score 80.0, E = 2.9e-19 *->ltrpsnvrSLQHLRLCRftIrrctttdeikkLPLPpklkdYLseyk< ++++++++SLQ+ +CR++I+rctt+d i++LPLP++l+d+L+ey+ KIAA0671 476 SLNRTFPFSLQY--ICRAVICRCTTYDGIDGLPLPSMLQDFLKEYH 519 -* KIAA0671 - - //